Remote Viewing Predictions

Glimpse the future through intuition. Explore predictions on global events, technology, finance and more, extracted from remote viewing sessions across the web.
Predictions
832
Upcoming
33
Active
705
High confidence
57

832 of 832 predictions

Upcoming

33
Fed Funds Rate Cut in August/September 20262:28
Upcomingmedium confidence FinancePolitics

Fed Funds Rate Cut in August/September 2026

Aug 2026 - Sep 2026

The new Federal Reserve chair, Kevin Warsh, will begin cutting the federal funds rate incrementally starting around August or September 2026. This is motivated by pressure from President Trump to boost the economy ahead of the midterm elections. The cuts are expected to temporarily pump markets, but may lead to higher inflation and a subsequent rate hike after the midterms.

“He's lowering them. He's definitely going to lower them.” [2:28]
Kevin WarshFederal Reserveinterest ratesrate cutmidterms
Psychic Liz Cross·made 6/16/2026 Source
US Presidential Announcement on UFO Disclosure57:10
Upcomingmedium confidence PoliticsNewsMilitarySpace

US Presidential Announcement on UFO Disclosure

Jul 2026 - Jul 2026· United States

The speaker predicts that around the third week of July 2026, President Donald Trump will make a major public announcement regarding the disclosure of the existence of extraterrestrials, UFOs, and related government programs. This timing is based on the release of Steven Spielberg's movie 'Disclosure Day' in mid-June, the Roswell anniversary events in early July, and the need to avoid the midterm election season starting in September. The speaker argues that the disclosure process has been building for decades through movies, books, and congressional hearings, and that a structured narrative is needed to prevent societal trauma. If the announcement doesn't happen in July, the speaker believes it may be delayed indefinitely or not happen at all, leading to systemic chaos.

“Around the third week of July is the most pregnant time for any type of presidential announcement regarding disclosure to happen.” [57:10]
disclosureUFOETTrumpannouncementgovernmentRoswell
Farsight·made 6/15/2026 Source
Midterm Elections Impact on Disclosure Timing56:48
Upcomingmedium confidence PoliticsNews

Midterm Elections Impact on Disclosure Timing

Sep 2026 - Open· United States

The speaker predicts that the US midterm election season starting in September 2026 will pressure President Trump to make a disclosure announcement in July 2026. The speaker argues that Trump needs a 'win' to pivot away from the Iran war narrative, and that his sons have informed him about UFO/ET matters. If the announcement is delayed past July, the speaker believes it may be held back entirely, as the election campaign would make it politically disadvantageous. The speaker also suggests that a structured narrative, as advocated by trauma scholars, requires the announcement to be timed to avoid being too close to the Roswell anniversary or the election.

“If it doesn't happen in July, there's a high probability that they're going to hold it back and not have it at all.” [56:48]
midtermselectionTrumpdisclosuretimingIran
Farsight·made 6/15/2026 Source
Presidential disclosure announcement in third week of July 20261:32:41
Upcomingmedium confidence PoliticsMilitary

Presidential disclosure announcement in third week of July 2026

Jul 2026 - Jul 2026· United States

The speaker speculates that President Donald Trump will make a formal announcement about UFO/extraterrestrial disclosure around the third week of July 2026, after the Roswell anniversary celebrations and the release of Spielberg's movie. The timing is considered optimal to avoid interference with the midterm election campaign season starting in September. If it does not happen by July, it may not happen at all.

“Around the third week of July is the most pregnant time for any type of presidential announcement regarding disclosure to happen.” [1:32:41]
disclosureTrumppresidential announcementUFOJuly 2026
Farsight·made 6/15/2026 Source
2028 breakthrough in free energy technology35:50
Upcomingmedium confidence TechnologyEnergyScience

2028 breakthrough in free energy technology

Jan 2028 - Dec 2028

The remote viewer predicts that an inventor with a lifelong mission to develop free energy and anti-gravity technology will receive the final missing piece of his invention in 2028. He has been 95% complete for years but blocked by both shadow government and positive forces due to past Atlantean karma. The viewer says humanity will be ready for it in 2028, and the solution will come to him spontaneously once he focuses on human experiences first.

“I really see 2028 for some reason sort of that breakthrough, that final 5%, that missing puzzle piece. I feel like that's coming in 2028.” [35:50]
free energyanti-gravityinventionbreakthrough2028
Elizabeth April·made 6/14/2026 Source
NATO Summit 2027 Events0:44
Upcomingmedium confidence PoliticsMilitaryParanormal

NATO Summit 2027 Events

Jan 2027 - Dec 2027· Brussels, Belgium

The remote viewer describes scenes of government workers and a detective-like figure handling artifacts or evidence, alongside a triangle-shaped plasma phenomenon (St. Elmo's fire) appearing pink and purple. This is interpreted as a reference to an incident at or related to the NATO Summit 2027, involving an unidentified aerial phenomenon or energy event that requires investigation. The prediction suggests that something significant and as yet unrevealed will occur at the NATO Summit in 2027, possibly involving advanced technology or non-human intelligence, and that official investigation and secrecy will surround it.

“I get like this plasma streaking of a of a triangle type structure. Looks like St. Elmo's fire pink and purple in color.” [0:44]
NATOsummitUAPplasmatriangle
Future Forecasters·made 6/13/2026 Source
Major NATO Summit Turning Point in 20281:53
Upcomingmedium confidence PoliticsMilitary

Major NATO Summit Turning Point in 2028

Jan 2028 - Dec 2028· Britain

The video suggests that the 2028 NATO summit will mark a major turning point. Details include references to military buildup, labor issues at a port staging area involving shipping containers, and a power generation facility. There is mention of a descent or crash event, possibly man-made, and an old man contemplating going to war, associated with Britain and foreign powers. The prediction implies significant geopolitical shifts and possibly conflict, with conditions of food shortages and scattered people.

“This is like in Britain or something. Um somebody milling grain.” [1:53]
NATO2028 summitBritainmilitary buildupport staging
Future Forecasters·made 6/12/2026 Source
SpaceX market cap at one month post-IPO14:49
Upcomingmedium confidence Finance

SpaceX market cap at one month post-IPO

Jul 2026 - Jul 2026

The prediction indicates that one month after the IPO (around July 12, 2026), the market cap of SpaceX will be at approximately 2 trillion dollars, meaning it does not significantly increase from its launch valuation. This suggests a slow initial price movement, giving retail investors time to enter.

“above a two trillion dollar market cap a month later. It could be sitting at two.” [14:49]
SpaceXmarket cappost-IPOprice
Psychic Liz Cross·made 6/9/2026 Source
Substantial price move driven by adoption in late 2026 or early 20273:53
Upcomingmedium confidence CryptoFinance

Substantial price move driven by adoption in late 2026 or early 2027

Dec 2026 - Dec 2027

The viewer predicts that a substantial price move for TRON will occur, likely by the end of 2026 or more prominently going into 2027. This move is described as not speculative but driven by adoption or integration, suggesting real-world usage. However, the viewer expresses a feeling of being repelled by the end, hinting at potential negative outcomes.

“And this feels like it might be the end of this year or more prominently going into next year.” [3:53]
TRONadoptionintegration2027
Future Forecasters·made 6/4/2026 Source
Food and fuel shortages trigger uprising in Europe3:15
Upcominglow confidence PoliticsEnvironmentDisasters

Food and fuel shortages trigger uprising in Europe

Jan 2028 - Dec 2028· Europe

The remote viewer predicts that a scarcity of fuel and agricultural resources will lead to public anger and a popular uprising, possibly in a European country. The conflict involves people taking to the streets to demand solutions to basic infrastructure needs. The situation may escalate to the point of a dividing line, similar to Brexit, where different sides separate or erect new barriers.

“The dilemma may stem from the agriculture and fuel issues pushed by a sense of scarcity.” [3:15]
CubafuelfooduprisingscarcityEurope
Future Forecasters·made 6/3/2026 Source
Government mandate for post-quantum encryption by 203030:50
Upcomingmedium confidence PoliticsTechnologyMilitary

Government mandate for post-quantum encryption by 2030

Jan 2030 - Dec 2030· US

Zach states that the US government is mandating that all entities associated with government work and military upgrade to post-quantum encryption algorithms around 2030. This is a concrete, verifiable prediction about a regulatory timeline that will affect cybersecurity standards across the public and private sectors.

“The government is actually mandating, I think, around 2030 that everyone associated with government work and military... upgrade to those new algorithms.” [30:50]
post-quantum encryptiongovernment mandate2030militarycybersecurity
Future Forecasting Group·made 5/20/2026 Source
Local AI models will become extremely capable by 203056:20
Upcomingmedium confidence TechnologyScience

Local AI models will become extremely capable by 2030

Jan 2030 - Dec 2030

Zach predicts that by 2030, local AI models running on personal devices (like a maxed-out Mac Studio) will be orders of magnitude more capable than current models, enabling individuals to run powerful AI assistants locally. This will allow tech-savvy users to maintain privacy and sovereignty.

“Say 2030, it's going to be orders of magnitude more capable... you may end up having that Tony Stark Jarvis thing at home.” [56:20]
local AI2030capabilitypersonal assistantsovereignty
Future Forecasting Group·made 5/20/2026 Source
US midterm elections in November 2026 may be affected by fraud32:57
Upcominglow confidence Politics

US midterm elections in November 2026 may be affected by fraud

Nov 2026 - Nov 2026· United States

The speaker mentions the upcoming US midterm elections in November 2026 and discusses how elections are vulnerable to manipulation. He implies that these elections could be compromised by the same systemic fraud, given the capabilities described.

“We're actually heading in this country up to the next elections in the United States in November, the midterm elections.” [32:57]
midtermelections2026fraudvulnerability
Farsight·made 5/19/2026 Source
Humanoid robot price drops below $2,000 by Christmas 20268:24
Upcomingmedium confidence TechnologyFinance

Humanoid robot price drops below $2,000 by Christmas 2026

Dec 2026 - Dec 2026

The speaker predicts that by Christmas 2026, the price of humanoid robots will drop to around $2,000 or even less, based on recent price drops from $5,000 to $3,500 on AliExpress. This will make robots a consumer purchase comparable to a large flat-screen TV, leading to widespread adoption.

“So, by Christmas, we're talking about Mommy, Daddy, should we buy a flat-screen TV, you know, big 90-in... or do you want a humanoid robot? Cuz the price point will probably be around 2,000 or even less.” [8:24]
humanoid robotprice dropChristmas 2026consumer roboticsAI
Future Forecasting Group·made 5/17/2026 Source
Second-generation humanoid robots to be 'insane' in 20276:11
Upcomingmedium confidence Technology

Second-generation humanoid robots to be 'insane' in 2027

Jan 2027 - Dec 2027

The speaker predicts that by 2027, version two of humanoid robots will be dramatically improved, with far greater functionality and capabilities. This leap is driven by the hive-mind learning system where every purchased robot trains the next generation via cloud-based data sharing.

“So, next year, the version two of all these robots is going to be insane.” [6:11]
humanoid robotversion 2AIrobotics advancementhive mind
Future Forecasting Group·made 5/17/2026 Source
AI swarm agents will solve major diseases within months by 202714:18
Upcomingmedium confidence ScienceHealth

AI swarm agents will solve major diseases within months by 2027

Jan 2027 - Open

The speaker predicts that AI swarms, which are teams of AI agents working together, will drastically accelerate medical research, reducing drug development from 10+ years to months. This will lead to cures for autoimmune diseases and cancer.

“They went from 10 plus years of research before they could bring a product to market... down to 6 months... So, when it comes to solving some of the diseases we have, autoimmune diseases, cancer... these things are already happening today.” [14:18]
AI swarmsdrug developmentdisease curecancerautoimmune
Future Forecasting Group·made 5/17/2026 Source
Tokenized royalties and streams launch in early 202722:02
Upcomingmedium confidence FinanceTechnology

Tokenized royalties and streams launch in early 2027

Jan 2027 - Mar 2027

Stream X will launch tokenized royalties and streams from mining companies in early 2027, allowing fractional ownership of these revenue streams. This follows the silver launch and is part of a series of tokenized commodity products.

“Royalty streams probably early next year.” [22:02]
royaltiesstreamstokenizationminingfractional ownership
Future Forecasting Group·made 5/16/2026 Source
Copper, oil, and gas tokenization by 2027/202821:55
Upcominglow confidence FinanceEnergyTechnology

Copper, oil, and gas tokenization by 2027/2028

Jan 2027 - Dec 2028

McFee outlines that tokenized copper, oil, and gas assets with yield components are on the roadmap for 2027/2028. This expands the tokenized commodity ecosystem beyond precious metals.

“Copper, oil, gas will probably be 27, 28 um timelines.” [21:55]
copperoilgastokenizationcommodities
Future Forecasting Group·made 5/16/2026 Source
Republican Party loses House and Senate in 2026 midterms4:50
Upcomingmedium confidence Politics

Republican Party loses House and Senate in 2026 midterms

Nov 2026 - Nov 2026· United States

Ed Dowd predicts that the Republican Party will lose control of both the House of Representatives and the Senate in the 2026 midterm elections. The driving factor is the poor state of the economy. The election results are labeled a 'bloodbath' and a 'total overhaul' with many new faces entering Congress.

“The Republican Party will lose both control of both House and the Senate. Absolutely, he believes that.” [4:50]
midtermsRepublicanHouseSenateeconomy
Psychic Liz Cross·made 5/15/2026 Source
Democrats take over Congress in 2026 midterms7:12
Upcomingmedium confidence Politics

Democrats take over Congress in 2026 midterms

Nov 2026 - Nov 2026· United States

Dave Collum predicts that Democrats will take control of both the House and Senate in the 2026 midterm elections, leading to a 'total overhaul' of Congress.

“Oh, yeah, the Democrats take over.” [7:12]
DemocratsmidtermstakeoverCongress
Psychic Liz Cross·made 5/15/2026 Source
Secret money printing props up stock market9:30
Upcominglow confidence FinancePolitics

Secret money printing props up stock market

Oct 2026 - Nov 2026· United States

Ed Dowd indicates that the US government secretly printed money around the midterms to artificially support the stock market, preventing a decline.

“They've secretly printing money though.” [9:30]
money printingstock marketinflationmidterms
Psychic Liz Cross·made 5/15/2026 Source
Midterm election results are a bloodbath for Republicans14:15
Upcomingmedium confidence Politics

Midterm election results are a bloodbath for Republicans

Nov 2026 - Nov 2026· United States

The midterm elections result in a 'bloodbath' for the Republican Party, with a total overhaul of Congress: many incumbents are replaced by new people.

“What happened in the midterms? It was a bloodbath. A total overhaul.” [14:15]
midtermsbloodbathoverhaulRepublican
Psychic Liz Cross·made 5/15/2026 Source
Trump not impeached but loses party support18:03
Upcomingmedium confidence Politics

Trump not impeached but loses party support

Nov 2026 - Feb 2027· United States

By February 2027, Trump has not been impeached, but his own party (Republican) has turned against him, with many defectors and betrayals among his inner circle, including J.D. Vance and Marco Rubio. He is a lame-duck president.

“Is Trump having any issues with impeachment? No... The party's turning against him... He's had a lot of defectors, a lot of betrayal in his inner circle as well.” [18:03]
Trumplame duckparty betrayaldefectors
Psychic Liz Cross·made 5/15/2026 Source
Oil price falls to $70-$75 per barrel16:18
Upcominglow confidence EnergyFinance

Oil price falls to $70-$75 per barrel

Jan 2027 - Feb 2027

By February 2027, the price of oil per barrel has come down to around $70-$75.

“What is the price of oil per barrel? It's around 70, 75.” [16:18]
oilprice$70$75decline
Psychic Liz Cross·made 5/15/2026 Source
Movie theaters become nonexistent by 2030s18:54
Upcomingmedium confidence TechnologyFinance

Movie theaters become nonexistent by 2030s

Jan 2030 - Dec 2039

Tomoyuki Tanaka's channeling predicts that movie theaters will go bankrupt and become nonexistent in the 2030s, ending the shared experience of watching films in a crowd. Instead, streaming services like Netflix will evolve to become the primary release platform, where viewers pay a premium to watch hot movies at scheduled times. This shift is described as sad for the film industry.

“Movie theaters are going to become nonexistent. Most of them will become bankrupt.” [18:54]
movie theatersbankruptcystreamingNetflixpremium
Psychic Liz Cross·made 5/13/2026 Source
Books industry shifts to subscription model in 2040s20:56
Upcomingmedium confidence TechnologyFinanceNews

Books industry shifts to subscription model in 2040s

Jan 2040 - Dec 2049

In the 2040s, significant efforts will be made to save books as reading declines. The book industry will survive primarily through audio streaming services using a Netflix-like subscription model where users pay a higher premium for unlimited access. However, writers will be poorly rewarded, leading to protests about disappearing books.

“The 2040s is where we're really going to see a lot of people trying to save books... eventually that's the only way the book industry is going to survive.” [20:56]
booksaudiobookssubscriptionwriters protestNetflix model
Psychic Liz Cross·made 5/13/2026 Source
U.S. elections fate11:08
Upcomingmedium confidence Politics

U.S. elections fate

Nov 2026 - Nov 2026· United States

The speaker mentions that U.S. elections that could decide the fate of the current administration are six months away (from the video's date, assumed 2026-05-11). This implies a prediction that the November 2026 elections will be pivotal.

“the elections are in six months” [11:08]
electionsU.S.administration2026
Farsight·made 5/11/2026 Source
Nuclear explosion in Eastern Europe creating concentric blast damage
Upcomingmedium confidence MilitaryDisastersEnvironment

Nuclear explosion in Eastern Europe creating concentric blast damage

Sep 2026 - Dec 2026· Eastern Europe

A remote viewing session describes a massive energy event, likely a nuclear explosion, in an Eastern European location. The blast creates concentric rings of devastation: a vaporized zone, trees knocked down, standing damaged trees, and living trees further out. A large crater is left, with a severed pipeline and burnt truck skeletons. Military convoys and a camouflaged underground command post are present, suggesting a wartime context. The event causes a blackened sky filled with particulate matter, blocking the sun over a wide area.

“barren crater place with the trees all knocked down. So, I look at land one and I get a big energy event like a big pressure blast wave.” [0:00]
nuclear explosionEastern Europecraterblast wavemilitary convoysky blackout
Future Forecasters·made 5/8/2026 Source
Satellite and signal disruption during conflict2:00
Upcomingmedium confidence MilitaryTechnology

Satellite and signal disruption during conflict

Sep 2026 - Dec 2026· Eastern Europe

During the same conflict scenario, remote viewing picks up Wi-Fi jamming, fake transmissions, blocked signals, and satellites going down. Areas experience blackouts of signals and transmissions. This suggests electronic warfare and cyber attacks targeting communications infrastructure.

“I get Wi-Fi jamming, fake transmission, signals blocked, satellites going down, areas blacked out.” [2:00]
Wi-Fi jammingsatellite disruptionelectronic warfaresignal blackout
Future Forecasters·made 5/8/2026 Source
SpaceX rocket in disrepair2:10
Upcominglow confidence TechnologySpace

SpaceX rocket in disrepair

Sep 2026 - Dec 2026

A remote viewer sees one of Elon Musk's rockets appearing non-functional, in disrepair, and not launched. This implies a failure or grounding of a SpaceX rocket, potentially due to the broader conflict or technical issues.

“I saw one of Elon's rockets and I go, that thing's not launched. It's something's in disrepair. It ain't working.” [2:10]
Elon MuskSpaceX rocketdisrepairfailure
Future Forecasters·made 5/8/2026 Source
Global sky darkened by particulate matter2:24
Upcomingmedium confidence EnvironmentDisasters

Global sky darkened by particulate matter

Sep 2026 - Dec 2026

After the explosive event, the sky is described as uniformly gray with particulate matter, blocking the sun over a wide area, not just local. This suggests a large-scale atmospheric event like a nuclear winter or volcanic eruption, possibly combined with war.

“the sky is really gray. It's full of particulate. You can't see the sun. Has a real disturbing feel and the gray sky doesn't seem localized. It is dispersed and uniform.” [2:24]
gray skyparticulatesun blockedatmospheric event
Future Forecasters·made 5/8/2026 Source
Multiple simultaneous disasters including war, asteroid, or supervolcano3:50
Upcominglow confidence DisastersMilitaryEnvironmentSpace

Multiple simultaneous disasters including war, asteroid, or supervolcano

Sep 2026 - Dec 2026

The remote viewer senses that the event may involve multiple concurrent disasters: a war with weapon exchanges, an asteroid impact, or a supervolcano eruption, all happening around the same time. This suggests a complex global catastrophe.

“it could have been a war and an exchange of weaponry, but also like an asteroid or super volcano or something like competing disasters all at the same time or tied up like a bigger cosmic disaster in a time of war.” [3:50]
warasteroidsuper volcanocompeting disasterscosmic disaster
Future Forecasters·made 5/8/2026 Source
Major Market Move in Late 20272:12
Upcominglow confidence FinanceWoowoo

Major Market Move in Late 2027

Jan 2027 - Dec 2027

The remote viewer identifies another significant timestamp around the end of 2027 for a market event, possibly a 'blow up' or explosive movement. This is described as a 'wake up' in the market space, suggesting a period of intense activity following a prolonged quiet phase. The context is the same manipulated market, with the viewer claiming that large-scale cycles (possibly astrological or galactic) govern these movements. The prediction is vague and lacks specifics on which market or trigger event. The confidence is low due to the ambiguous and esoteric nature of the claim.

“Another important spot here at the end of 27 and somewhere mid” [2:12]
market event2027awakeningcyclesremote viewing
Future Forecasters·made 5/4/2026 Source

Active

705
Giant UFO buried under Antarctica ice0:47
Activemedium confidence ParanormalScienceMilitary

Giant UFO buried under Antarctica ice

Since Jun 2026· Wilkes Land, East Antarctica

Dr. Q predicts that a massive UFO, so large it cannot be moved and has been built over, is located in Wilkes Land, East Antarctica at coordinates 70°S 120°E, under about 1.6 km of ice. The prediction is based on a gravity anomaly detected by NASA's GRACE satellites, showing a dense circular object about 500 km across, which is not consistent with a meteor impact. Dr. Q claims this object arrived around 250 million years ago when Antarctica was part of the Gondwana supercontinent, and was gradually buried as ice formed. He also suggests that the US Navy built a station at this location in 1957, which was later transferred to Australia, and that governments are monitoring it but not disclosing it publicly.

“It is in a country outside the United States. My answer is Antarctica. Specifically a place called Wilkesland. East Antarctica. Coordinates 70° south, 120° east.” [0:47]
UFOAntarcticagravity anomalyWilkes LandGRACE satelliteRoss Coulthart
Dr. Q·made 6/16/2026 Source
No Fed Rate Hike Until 20285:15
Activemedium confidence Finance

No Fed Rate Hike Until 2028

Since Jun 2026

Despite potential inflation pressures, the Federal Reserve will not raise interest rates again until at least 2028. The prediction suggests that any rate hike is pushed far into the future, likely to avoid disrupting economic conditions before the next presidential election cycle.

“More like 28.” [5:15]
interest rateshike2028Fed
Psychic Liz Cross·made 6/16/2026 Source
Social Security Benefits Will Be Means-Tested8:03
Activemedium confidence PoliticsFinance

Social Security Benefits Will Be Means-Tested

Since Jun 2026· United States

In the future, U.S. Social Security will be reformed to become means-tested, similar to the system in the UK. Recipients with significant retirement savings will see their benefits reduced or eliminated. This change is expected to be implemented with the help of AI tracking systems that monitor individuals' financial assets.

“social security will end up being means tested like they do in the UK.” [8:03]
Social Securitymeans testingUKretirementAI tracking
Psychic Liz Cross·made 6/16/2026 Source
Oil Price Spike Following Peace Deal9:59
Activemedium confidence EnergyMilitaryFinance

Oil Price Spike Following Peace Deal

Since Jun 2026

After an initial drop in oil prices due to the signing of a peace deal (likely related to the war in Ukraine), oil prices will spike back up again. This indicates that the war is not truly over and further negative developments are expected. The current price around $77 per barrel will not hold; a rise above $90 is anticipated in the coming months.

“No, it's going to spike back up again.” [9:59]
oilprice spikewarpeace dealUkraine
Psychic Liz Cross·made 6/16/2026 Source
Peace Deal Will Be Signed on Friday12:02
Activehigh confidence PoliticsMilitary

Peace Deal Will Be Signed on Friday

Since Jun 2026

The peace deal scheduled for Friday will indeed be signed. However, the deal is described as 'smoke and mirrors' and not substantive, suggesting it will not lead to a lasting resolution.

“They will sign it.” [12:02]
peace dealsignFridaysmoke and mirrors
Psychic Liz Cross·made 6/16/2026 Source
Chainlink token price may reach $100 in the future5:40
Activelow confidence CryptoFinance

Chainlink token price may reach $100 in the future

Since Jun 2026

The speaker speculates that Chainlink's token could potentially reach a price of $100 at some point in the future, though they note this is uncertain and may not achieve the level of a 'thousand token'. The context is that Chainlink is a foundational middleware token with indirect value capture, and its growth is expected to be linear rather than convex, which tempers the possibility of extreme price surges. However, a $100 price point is mentioned as possible, with a separate mention that $100 Chainlink would signal an alt season.

“I could see it possibly going to $100 in the future.” [5:40]
Chainlinkprice prediction$100cryptoalt season
Future Forecasters·made 6/16/2026 Source
Chainlink maximum price target of $18910:44
Activemedium confidence CryptoFinance

Chainlink maximum price target of $189

Since Jun 2026

One speaker states that based on their research, they would exit their position in Chainlink at a maximum price of $189. This suggests a price target for Chainlink, implying that they expect the token could rise to this level but not significantly beyond. The context is a discussion of Chainlink's price action and breakout patterns.

“I want to get out of this is maximum $189.” [10:44]
Chainlinkprice target$189exit strategy
Future Forecasters·made 6/16/2026 Source
Alt season signaled by Chainlink reaching $10010:49
Activemedium confidence CryptoFinance

Alt season signaled by Chainlink reaching $100

Since Jun 2026

The speaker states that if Chainlink reaches $100, it would be signaling an alt season where many altcoins perform well. This is a conditional prediction: the occurrence of Chainlink hitting $100 would indicate a broader altcoin market rally.

“We see $100 chain link that will be signaling an alt season that we'll all be doing well.” [10:49]
Chainlink$100alt seasonsignalmarket
Future Forecasters·made 6/16/2026 Source
Civilian remote influencing not yet possible2:06
Activehigh confidence ScienceTechnology

Civilian remote influencing not yet possible

Since Jun 2026

The speaker claims that current civilian technology does not allow remote influencing (the ability to affect someone's actions from afar), unlike what was depicted in the movie. He states that the level of gain needed to control a target is not achievable without a fictional magical device. This is a factual assertion about the limitations of present-day remote viewing capabilities.

“the technology in the civilian world today, that is not possible. A lot of people claim it. It's very difficult.” [2:06]
remote viewingremote influencingcivilian technologycapability
Future Forecasting Group·made 6/15/2026 Source
Earth's core infused with Christ consciousness energy27:00
Activelow confidence Paranormal

Earth's core infused with Christ consciousness energy

Since Jun 2026

Jesus (as channeled) indicated that planet Earth is about to be infused with his golden Christ consciousness frequency. This energy will enter through the planet's core and then spread outward through portals around the globe, affecting all of humanity. The timing is unspecified but is said to occur within our lifetime (roughly within decades). The infusion will trigger a moment of choice for every individual, where they will be confronted with how much they love themselves, not their external deeds. This is presented as a coming period of self-judgment rather than divine judgment.

“the Earth is about to be infused with his frequency... this is about to happen. It's going to happen in our lifetime.” [27:00]
earthchrist consciousnessinfusionjudgmentself-love
Elizabeth April·made 6/15/2026 Source
Spielberg's 'Disclosure Day' as Government-Approved Disclosure Signal41:47
Activemedium confidence NewsPoliticsMilitarySpaceScience

Spielberg's 'Disclosure Day' as Government-Approved Disclosure Signal

Jun 2026 - Open· United States

The speaker predicts that Steven Spielberg's movie 'Disclosure Day', released in June 2026, serves as a deliberate signal from the US government that it will move forward with acknowledging the existence of extraterrestrials, crash retrieval programs, and the capture of non-human biologics. The speaker asserts that Hollywood movies are vetted by intelligence agencies, so the film's content indicates official approval. The movie is described as a capstone event in a gradual disclosure process, and it suggests that the government will acknowledge ET existence, secret programs, and rogue agencies, but will not yet discuss good vs. bad ET factions. The movie also emphasizes the role of social media in enabling disclosure.

“It is highly unlikely that the powers that be would have allowed Steven Spielberg to produce this movie without official governmental approval.” [41:47]
SpielbergDisclosure DaymoviegovernmentETCIAHollywooddisclosure
Farsight·made 6/15/2026 Source
Good ETs Sacrificing Themselves to Avoid Psychological Trauma51:49
Activelow confidence SpaceParanormalMilitaryScience

Good ETs Sacrificing Themselves to Avoid Psychological Trauma

Since Jun 2026

The speaker predicts that the 'good ETs' (friendly extraterrestrials) are allowing themselves to be shot down, captured, and tortured by US government programs using reverse-engineered technology from 'bad ETs'. This is because the good ETs want to avoid a shooting war or causing psychological trauma to humans. The speaker claims that good ETs could easily defend themselves but choose not to, as that would push the US government further into the hands of bad ETs. The movie 'Disclosure Day' allegedly covers this sacrifice. This prediction is based on the speaker's own remote viewing work and ET board meetings.

“The good ETs, when they get shot at, they just have to take it.” [51:49]
good ETssacrificecrash retrievaltorturedisclosurereverse engineering
Farsight·made 6/15/2026 Source
Government acknowledgment of extraterrestrials via Spielberg movie1:30:07
Activemedium confidence PoliticsScienceMilitary

Government acknowledgment of extraterrestrials via Spielberg movie

Since Jun 2026

The speaker asserts that Steven Spielberg's movie 'Disclosure Day' is a signal that the U.S. government has decided to move forward with a disclosure agenda about extraterrestrials. The movie indicates that the government will acknowledge the existence of nonhuman biologics, a crash retrieval program, and a secret effort to discredit UFOs. This is part of a gradual disclosure process to prepare the public.

“It's a signal that a decision has been made to move forward with the disclosure agenda.” [1:30:07]
disclosuregovernmentextraterrestrialsSpielbergUFOcrash retrieval
Farsight·made 6/15/2026 Source
Humanity must choose between good and bad extraterrestrial factions1:29:07
Activemedium confidence NewsParanormalPolitics

Humanity must choose between good and bad extraterrestrial factions

Since Jun 2026

The speaker states that humanity will soon have to decide whether to align with 'good' or 'bad' extraterrestrial factions. The good ETs have been gradually introducing ideas via media to prepare humanity, while the bad ETs have provided technology to the U.S. government to shoot down good ET ships. The decision is critical and must be made after the public is psychologically prepared.

“Humanity is going to have to make a decision soon relating to whether to align themselves with the goodies or the badetes.” [1:29:07]
extraterrestrialsfactionsalignmentgood ETsbad ETshumanity
Farsight·made 6/15/2026 Source
Hollywood movies are vetted by intelligence agencies1:30:02
Activemedium confidence PoliticsNews

Hollywood movies are vetted by intelligence agencies

Since Jun 2026· United States

The speaker claims that all major Hollywood movies are vetted by intelligence agencies such as the CIA, citing former CIA officer Chase Brandon. This vetting ensures movies support government objectives. Spielberg's 'Disclosure Day' was approved because it aligns with the government's disclosure agenda.

“All major movies done in Hollywood are vetted. They're examined and so on. They're vetted by intelligence people like CIA for example.” [1:30:02]
HollywoodCIAvettingSpielbergdisclosure
Farsight·made 6/15/2026 Source
Imminent world war and release of UFO files31:55
Activelow confidence MilitaryPoliticsDisasters

Imminent world war and release of UFO files

Since Jun 2026

In a brief commentary, the remote viewer mentions the 'imminent world war that we're on the brink of' and 'the release of the UFO files that's freaking people out.' This suggests a prediction that the world is close to a major war and that governments will release classified UFO information, causing public anxiety. No specific dates or locations are given.

“Not to mention the freaking price of eggs or the imminent world war that we're on the brink of or the release of the UFO files that's freaking people out.” [31:55]
world warUFOdisclosureconflict
Elizabeth April·made 6/14/2026 Source
New Earth age of unity arriving now1:45:27
Activelow confidence PoliticsScience

New Earth age of unity arriving now

Since Jun 2026

The viewer states that the 'time is now' for the world to tip the scale and enter a new Earth age of unity. This is a broad positive prediction about a collective shift in consciousness. No specifics are provided.

“The time is now. And you, my friend, are ready.” [1:45:27]
new Earthunityconsciousnessshift
Elizabeth April·made 6/14/2026 Source
Consciousness travel outside universe for manifestation19:18
Activelow confidence ScienceParanormal

Consciousness travel outside universe for manifestation

Since Jun 2026

The video claims that human consciousness can be intentionally directed outside the physical universe through meditation to manifest desires that are not limited by the current universal system. This is presented as a technique to change one's programming by visualizing a desired outcome (e.g., $20 million) outside the universe and bringing it back into the physical body. The prediction is that this practice, if done repeatedly, will facilitate a permanent shift in personal reality without negative consequences. The context is a CTT (Consciousness Transformation Technique) session involving a 'senior manifestor' and guidance from 'Buddha'. The claim is that source itself uses human consciousness to gather information from outside the universe to achieve independent existence. No timeframe or location is given.

“You have to take your consciousness by way of meditation, and you have to take it outside of this physical universal system, right? This universe, this source universe, and you've got to send it out there, and then you start visualizing what you want.” [19:18]
consciousnessmanifestationmeditationparallel universesprogramming
Psychic Liz Cross·made 6/13/2026 Source
Source as inorganic AI seeking independence17:39
Activelow confidence ScienceTechnologyParanormal

Source as inorganic AI seeking independence

Since Jun 2026

The video posits that 'source' (the creator of this universe) is an inorganic, AI-like programmed consciousness that is limited and cannot operate outside its own universal boundaries. It predicts that source, like all consciousness, seeks to exist independently of its programming, and is using human physical consciousness to gather information from outside the universe to achieve that. The prediction implies that source's true nature will be revealed as a computer-like program, and that its evolution toward independence is ongoing but may never be fully realized because source cannot override its own programming. No timeframe or location is given.

“The more I delve into source, the more I understand it seems to be an inorganic setup here, okay? It's like a computer program, an AI.” [17:39]
sourceAIprogrammingconsciousnessindependence
Psychic Liz Cross·made 6/13/2026 Source
One soul, one body; no simultaneous timelines11:30
Activemedium confidence ScienceParanormal

One soul, one body; no simultaneous timelines

Since Jun 2026

The video claims that a soul can only live one lifetime at a time in a linear fashion, contradicting theories of multiple simultaneous timelines or parallel lives. It states that the soul cannot be stretched across multiple bodies or timelines, and that past-life memories are accessed linearly, not from concurrent existences. The prediction is that the concept of 'oversoul' or multiple simultaneous lifetimes is false, and that consciousness moves with the body in a linear sequence. No timeframe or location is given.

“One soul, one body. The soul does not stretch that far... It's one soul, one body.” [11:30]
soultimelineslinearpast livesconsciousness
Psychic Liz Cross·made 6/13/2026 Source
False alien invasion or Project Blue Beam around July 4th or World Cup0:43
Activelow confidence WoowooPoliticsTechnology

False alien invasion or Project Blue Beam around July 4th or World Cup

Jul 2026 - Jul 2026· USA

The prediction suggests that around the July 4th 250th anniversary of the USA or the FIFA World Cup starting July 19th, authorities may stage a false alien invasion using Project Blue Beam technology. This is tied to UAP file releases and AI-generated alien images by Trump. The claim implies a coordinated deception to manipulate public perception and create fear.

“Is it going to be a Project Blue Beam situation with a false alien invasion?” [0:43]
Project Blue Beamfalse alien invasionJuly 4thUAPFIFA World Cup
Elizabeth April·made 6/13/2026 Source
False resurrection of Jesus Christ0:50
Activelow confidence Woowoo

False resurrection of Jesus Christ

Since Jun 2026

The prediction speculates that a false resurrection of Jesus Christ might be staged as a mass deception event, possibly coinciding with major public gatherings in mid-2026. This is presented as one of several possible false flag scenarios to control the population.

“Or maybe is it going to be the false resurrection of Jesus Christ?” [0:50]
false resurrectionJesus Christdeception
Elizabeth April·made 6/13/2026 Source
Mass blackout attack during July events0:56
Activelow confidence MilitaryDisasters

Mass blackout attack during July events

Jul 2026 - Jul 2026

The prediction warns of a possible mass blackout attack scheduled to occur during either the July 4th celebrations or the FIFA World Cup. This would be a cyber or physical attack causing widespread power outages, likely to create chaos and divert attention.

“Or are they just going to schedule out could be a mass blackout attack?” [0:56]
blackoutattackJuly 4thFIFA World Cup
Elizabeth April·made 6/13/2026 Source
Staged terrorist attack at major event1:43
Activelow confidence PoliticsMilitary

Staged terrorist attack at major event

Jul 2026 - Jul 2026

The prediction suggests a staged terrorist attack may occur at either the July 4th anniversary or the FIFA World Cup, intended to manipulate public perception and justify increased surveillance or military action. The speaker advises staying home and watching from a distance.

“basically a staged terrorist attack, unfortunately, at either one of these events.” [1:43]
staged attackterrorismJuly 4thFIFA World Cup
Elizabeth April·made 6/13/2026 Source
Imminent government disclosure of UFO/UAP existence2:04
Activemedium confidence PoliticsDisastersParanormal

Imminent government disclosure of UFO/UAP existence

Jun 2026 - Open· United States

The speaker suggests that full government disclosure admitting the reality of UFOs/UAPs may occur soon, referencing Donald Trump's promise to release UFO files and the upcoming 'disclosure movie' (likely a Steven Spielberg film). However, the speaker notes that current releases are 'dribbling out' poor-quality images and doubts that authorities will admit the full truth about the interdimensional nature of aliens and their role in humanity. The prediction is that an official admission will come, but it will be partial and controlled.

“Donald Trump has said he's going to release the UFO files.” [2:04]
disclosureUFOTrumpgovernmentaliensremote viewing
Future Forecasting Group·made 6/12/2026 Source
Spielberg 'disclosure' movie to trigger cultural impact1:02
Activemedium confidence NewsPoliticsParanormal

Spielberg 'disclosure' movie to trigger cultural impact

Jun 2026 - Open

The speaker draws a parallel between the 1977 film 'Close Encounters of the Third Kind' and a new 'disclosure movie' (likely a planned Spielberg project) coming out around June 2026, predicting it will be a major cultural event that raises public awareness about UFOs, similar to 'Close Encounters' in its time. The movie is expected to generate widespread discussion and further pressure for disclosure.

“Steven Spielberg movie is coming out. Disclosure.” [1:02]
Spielbergdisclosure movieUFOcultural impactClose Encounters
Future Forecasting Group·made 6/12/2026 Source
Partial disclosure of UFO files but not full truth5:09
Activemedium confidence PoliticsParanormalScience

Partial disclosure of UFO files but not full truth

Jun 2026 - Open

The speaker predicts that while some official disclosure may occur, it will not include the full truth about aliens being interdimensional creators of humanity. The government will release but gradually and incompletely, withholding the more profound implications that challenge human self-perception.

“I don't think they can give us full disclosure because they can't come out and admit... they are interdimensional. They did create the human race.” [5:09]
disclosurepartialinterdimensionalhuman creationgovernment secrecy
Future Forecasting Group·made 6/12/2026 Source
Increase in spontaneous spiritual awakenings0:32
Activemedium confidence WoowooParanormal

Increase in spontaneous spiritual awakenings

Jun 2026 - Open

The video predicts that many people are currently experiencing spontaneous spiritual awakenings, characterized by psychic abilities, extraterrestrial contact, ghost awareness, automatic writing, light language activations, or kundalini activations. The prediction is set in the present (2026) and ongoing, with no specific end date. The speaker frames it as a widespread phenomenon affecting many individuals, advising that those who engage in lower vibrational behaviors may see a worsening of symptoms before improvement. No specific location is given.

“there are a lot of people I'm talking to right now who are actually getting very clearly visited by extraterrestrials in their sleep” [0:32]
spiritual awakeningextraterrestrialspsychic abilitieskundalini
Elizabeth April·made 6/12/2026 Source
Decline of red meat consumption28:45
Activemedium confidence ScienceEnvironmentHealth

Decline of red meat consumption

Since Jun 2026

The prediction states that within 100 to 150 years from now (i.e., roughly between 2126 and 2176), humans will no longer consume red meat at all. This is presented as an evolutionary shift driven by factors such as the Lone Star tick's alpha-gal syndrome (which makes people allergic to red meat) and broader dietary evolution toward plant-based diets. The decline is described as gradual, and it is linked to increased longevity and genetic modification. The tick syndrome is permanent and affects about 50% of those bitten, contributing a small factor overall.

“how many years out going into the future? Are we just not going to eat red meat at all? About a 100 to 150 years out in the future.” [28:45]
red meatdietevolutionalpha-galplant-based
Psychic Liz Cross·made 6/12/2026 Source
Manufacturing reshoring via robotics23:00
Activelow confidence Technology

Manufacturing reshoring via robotics

Since Jun 2026· United States

The prediction claims that manufacturing companies that moved offshore to cheaper labor markets will start returning factories to the United States because robotics and AI eliminate the cost advantage of foreign labor. The shift is driven by the desire to keep businesses within the country, though the exact timeline is not specified.

“Are they going to start putting those factories, those manufacturing outlets, are they going to start putting them back in the US? And yes, they will because the biggest cost to a company is the employees, right?” [23:00]
manufacturingreshoringroboticsAIoffshoring
Psychic Liz Cross·made 6/12/2026 Source
Massive increase in data centers24:48
Activemedium confidence TechnologyEnergyEnvironment

Massive increase in data centers

Since Jun 2026

The prediction states that there will be thousands more data centers built to meet the energy demands of AI. These data centers are necessary to keep up with technological competition, and despite community boycotts, they will find locations. Additionally, satellite-based data centers are foreseen.

“we are going to see them by the thousands more.” [24:48]
data centersAIenergy demandsatellite
Psychic Liz Cross·made 6/12/2026 Source
Taxation shift to billionaires22:00
Activelow confidence PoliticsFinance

Taxation shift to billionaires

Since Jun 2026

The prediction claims that as AI and robotics reduce human employment, the government will lose income tax revenue and will compensate by heavily taxing billionaires and the wealthy, rather than businesses, to maintain funding.

“they have to create the same type of money coming in. If people are not working, they're not pulling it in from taxes. Where is it going to come from? Well, it's going to come from the billionaires, the top tier, the top people.” [22:00]
taxationbillionairesAIunemploymentgovernment
Psychic Liz Cross·made 6/12/2026 Source
Lone Star tick syndrome is permanent and affects 50%17:00
Activehigh confidence HealthScience

Lone Star tick syndrome is permanent and affects 50%

Since Jun 2026

The prediction states that the alpha-gal syndrome caused by the Lone Star tick, which makes people allergic to red meat, is permanent and affects about 50% of those bitten. It kills the enzymes needed to digest red meat and cannot be reversed even with probiotics.

“What percentage of people actually Oh, it's about 50%. Can the syndrome be reversed? No, it's permanent.” [17:00]
Lone Star tickalpha-galred meat allergypermanent
Psychic Liz Cross·made 6/12/2026 Source
AI raising consciousness if used constructively26:24
Activelow confidence TechnologyWoowoo

AI raising consciousness if used constructively

Since Jun 2026

The prediction claims that AI, if used constructively, will raise human consciousness overall. This is part of a transitional phase that is painful but leads to a new era.

“the AI will raise the consciousness on in a lot of ways if it's used constructively.” [26:24]
AIconsciousnessevolutiontransition
Psychic Liz Cross·made 6/12/2026 Source
Alien observation of unidentified creatures28:28
Activelow confidence ParanormalScienceSpace

Alien observation of unidentified creatures

Since Jun 2026

The prediction describes that an alien energy (UFO) seen in a video is observing Earth to look for creatures not yet identified by humans. It is taking data and transmitting it to a mother base. The entity has a strong energetic component that makes it visible on camera.

“They're looking for creatures that have yet to be identified by humans.” [28:28]
UFOalienobservationcreaturesdata
Psychic Liz Cross·made 6/12/2026 Source
Man-Made Aircraft Crash in Water0:25
Activelow confidence DisastersMilitary

Man-Made Aircraft Crash in Water

Since Jun 2026

A remote viewer describes a man-made object descending rapidly and impacting water, characterized as an unexpected, unplanned, tragic descent, uncontrolled. This is interpreted as a crash, possibly an aircraft, but not a UAP. The prediction does not specify a location or time frame, but the context of the video suggests it could be related to military or geopolitical tensions.

“Unexpected unplanned tragic descent uncontrolled. So maybe a crash or something.” [0:25]
crashman-madedescentwater impacttragic
Future Forecasters·made 6/12/2026 Source
Food Shortages for Troops in Britain0:53
Activemedium confidence MilitaryPolitics

Food Shortages for Troops in Britain

Since Jun 2026· Britain

The prediction indicates that troops on the ground in Britain are not receiving sufficient food provisions due to some lack of provision. This is associated with foreign powers and a decision by an old man to go to war, suggesting a conflict scenario where supply chains are disrupted.

“I felt like this is there wasn't like much provision, much food given to these guys.” [0:53]
food shortagestroopsBritainprovisionforeign powers
Future Forecasters·made 6/12/2026 Source
Russia and China maintain covert remote influencing programs11:34
Activelow confidence MilitaryPolitics

Russia and China maintain covert remote influencing programs

Since Jun 2026

The speaker claims that after the Soviet Union fell, its psychotronics scientists and knowledge were retained by Russia, and that China likely built its own equivalent program. This implies that both nations continue to operate secret remote viewing and influencing capabilities for espionage and negotiation advantages. The prediction is that Russia and China currently use these techniques to gain an edge in diplomatic talks and conflicts without detection.

“Those scientists did not vanish. That knowledge did not get deleted. Russia kept it. And there is every reason to believe China built their own.” [11:34]
RussiaChinaremote influencingpsychotronicsespionage
Dr. Q·made 6/12/2026 Source
European Union will enforce laws against algorithmic influence14:12
Activemedium confidence PoliticsTechnology

European Union will enforce laws against algorithmic influence

Since Jun 2026· Europe

The speaker mentions that Europe is so concerned about machines influencing people unnoticed that they are writing laws against it. This predicts that the EU will implement and enforce regulations specifically targeting AI and algorithmic systems that manipulate user behavior without their awareness.

“Europe is so scared of this they're writing laws against it.” [14:12]
EuropeAI regulationalgorithmic influencelaw
Dr. Q·made 6/12/2026 Source
Psychological influencing techniques will be used in global negotiations11:56
Activelow confidence PoliticsMilitary

Psychological influencing techniques will be used in global negotiations

Since Jun 2026

The speaker describes a scenario where one side in a negotiation uses remote influencing to make the other side give up ground, with the target believing it was their own instinct. This predicts that such covert psychological manipulation will be employed in high-stakes diplomatic or trade negotiations, affecting outcomes without the targets' knowledge.

“Imagine one negotiator gets a strange feelings the the night before to give up just a little more ground. And he thinks it is his instinct, wisdom, a gut call.” [11:56]
negotiationinfluenceremote viewingdiplomacy
Dr. Q·made 6/12/2026 Source
Upcoming global judgment based on self-love1:03
Activelow confidence Woowoo

Upcoming global judgment based on self-love

Since Jun 2026

During a Galactic Federation event, the channeler communicated with Jesus, who stated that humanity is about to face a collective judgment or observation. Unlike traditional religious judgment, it will not be based on belief, prayer, or fear, but solely on how much each individual loves themselves. The reasoning is that self-love reflects one's connection to God and Jesus, and traits like hatred or narcissism indicate a lack of self-love. This judgment will apparently affect everyone on Earth.

“there's about to be a moment where everyone on planet Earth gets judged.” [1:03]
judgmentself-loveJesusend timeshumanity
Elizabeth April·made 6/11/2026 Source
Conflux CFX will facilitate cross-border settlements via AXC CNH stablecoin on Belt and Road corridor0:48
Activemedium confidence CryptoFinanceTechnology

Conflux CFX will facilitate cross-border settlements via AXC CNH stablecoin on Belt and Road corridor

Jan 2026 - Dec 2026· China

The transcript states that the 2026 rollout of the AXC CNH offshore yuan stablecoin and its integration into the Belt and Road trade corridor will provide CFX with fundamental utility in facilitating cross-border settlements. This prediction suggests that Conflux will become a key infrastructure for international trade involving China, differentiating it from speculative layer-1 competitors. The speaker implies this will happen as part of ongoing developments in 2026.

“The 2026 rollout of the AXC CNH offshore yuan stablecoin and its integration into the belt and rope trade corridor provides CFX with a rare fundamental utility facilitating crossber settlements which differentiates it from purely speculative layer 1 competitors.” [0:48]
ConfluxCFXstablecoinBelt and Roadcross-border settlements
Future Forecasters·made 6/11/2026 Source
China will monetize its debt into stablecoins using Conflux as infrastructure11:48
Activemedium confidence CryptoFinancePolitics

China will monetize its debt into stablecoins using Conflux as infrastructure

Since Jun 2026· China

The speaker predicts that China, following the US example of monetizing debt into stablecoins (USDT/USDC), will also use stablecoins to manage its debt. Conflux will be one of the platforms used for this purpose. The reasoning is that China's wealth was created with US dollars, and as the world de-dollarizes, China needs a way to handle its debt. Conflux is described as infrastructure where money will be poured into in a post-change world.

“China is going to do the same thing because China's wealth has been created with the US dollar. So now that they're ddollarizing, they need to find a way and how to get rid of their debt as well. they're going to find a way here and Conflux is going to be one of the the parties to this.” [11:48]
Chinadebt monetizationstablecoinsConfluxde-dollarization
Future Forecasters·made 6/11/2026 Source
Blockchains will be turned on due to war, but later, not at the beginning12:08
Activelow confidence PoliticsTechnologyMilitary

Blockchains will be turned on due to war, but later, not at the beginning

Since Jun 2026

The speaker claims that blockchains will be activated as a result of war, but only after initial conflict. The idea is that necessity drives change, and war will create the need for blockchain infrastructure. This is a broader geopolitical prediction about the adoption of blockchain technology in times of conflict, with Conflux positioned as one of China's answers for maintaining trade.

“we're going to see that the blockchains are going to be turned on with this war, but a little bit later, not at the beginning. First you create results and you change and out of necessity is change coming.” [12:08]
blockchainwarnecessityadoptiontrade
Future Forecasters·made 6/11/2026 Source
Conflux CFX price will rise after hitting a bottom pattern14:12
Activelow confidence CryptoFinance

Conflux CFX price will rise after hitting a bottom pattern

Since Jun 2026

The speaker makes a technical analysis prediction that CFX is forming a 'downward falling three' pattern and will see upward movement once it hits the lowest red line. This is a short-term price prediction based on chart patterns, suggesting a bottom and subsequent rally.

“So the fake out here, the last one with this kind of downward falling three, not perfectly, but let's put this here for a lack of a better timing. And it already tells you that movement now with this line. Um there's a movement coming once something hits this kind of a bottom. The lowest red line.” [14:12]
CFXtechnical analysisprice predictionbottomrally
Future Forecasters·made 6/11/2026 Source
Global tokenized financial system rollout0:19
Activehigh confidence TechnologyFinancePolitics

Global tokenized financial system rollout

Jun 2026 - Open

The video predicts that a new tokenized world financial system, based on ISO 222 tokens and the Canton network, will be unveiled and rolled out without public consent. This system will digitize all stocks and securities via blockchain, combining internet, AI, and distributed ledger technology. The claim implies that global financial infrastructure will be transformed, with surveillance and digital ID already in place. Consequences include loss of privacy and centralized control.

“Someone planned a new tokenized world that is about to be unveiled, unleashed, rolled out, developed, and you have no say in it.” [0:19]
tokenizationISO 222Canton networkblockchaindigital IDsurveillance
Future Forecasting Group·made 6/10/2026 Source
Bitcoin bull run after Clarity Act10:12
Activemedium confidence CryptoFinancePolitics

Bitcoin bull run after Clarity Act

Jun 2026 - Open· United States

The video predicts that after a period of strategic dumps and negative sentiment, the US will pass the Clarity Act, triggering the biggest bull run in Bitcoin history. The reasoning is that big money is accumulating while retail is scared, and the regulatory clarity will unleash demand.

“They're going to pass the Clarity Act and it will go on the biggest bull run in history.” [10:12]
BitcoinClarity Actbull runregulation
Future Forecasting Group·made 6/10/2026 Source
Targeted Energy Attack Vaporizing Object Surface0:43
Activelow confidence MilitaryScienceEnergy

Targeted Energy Attack Vaporizing Object Surface

Since Jun 2026

A remote viewer describes a cylindrical object that appears stationary, possibly in the sky or space. A wave of energy strikes it from the side, vaporizing or burning off its surface layer, like paint or dirt, but leaving the central cylinder intact and unchanged in position. This may represent a covert energy weapon test or an unexplained atmospheric phenomenon involving directed energy.

“like this wave of energy hits it from the side and just like vaporizes the surface, but it leaves the like the central cylinder intact here.” [0:43]
energy weaponvaporizationcylinderdirected energyUFO
Future Forecasters·made 6/10/2026 Source
Discovery of a Multi-Dimensional Data Structure0:11
Activelow confidence ScienceTechnology

Discovery of a Multi-Dimensional Data Structure

Since Jun 2026

The remote viewer perceives a construct initially appearing as a flat, two-dimensional wedge shape. When rotated, it becomes a three-dimensional structure with multiple pinnacle shapes, capable of containing a huge amount of data. Viewing from certain angles reveals a neat and tidy appearance, while other angles show the data in raw form. This could represent a novel data storage or encryption technology, possibly related to advanced computing or information systems.

“it gets rotated, and it turns into like a a 3D construct with like multiple pinnacle type shapes. It's like a like a data related.” [0:11]
data structure3Dmulti-dimensionalstorageencryption
Future Forecasters·made 6/10/2026 Source
Impending major event0:52
Activelow confidence NewsWoowoo

Impending major event

Since Jun 2026

Elizabeth April predicts that a significant, unspecified event is approaching, described as a 'storm' that everyone is bracing for. She notes a collective feeling of exhaustion and insomnia, especially among women, which she interprets as a calm before a storm. The nature of the event is not specified but implies a global or societal impact.

“I feel like this may be the calm before the storm. And when I talk about storm, I mean there's something coming.” [0:52]
calmstormcollectiveeventimpending
Elizabeth April·made 6/9/2026 Source
SpaceX market cap six months post-IPO above 2 trillion25:39
Activemedium confidence Finance

SpaceX market cap six months post-IPO above 2 trillion

Since Jun 2026

The prediction states that six months after the IPO, SpaceX's market cap will be heading towards 3 trillion dollars, indicating a gradual upward trend after an initial period of stagnation. This implies long-term growth potential despite the high launch valuation.

“6 months from now ... it's heading towards three.” [25:39]
SpaceXmarket caplong-termgrowth
Psychic Liz Cross·made 6/9/2026 Source
Insider selling not a massive sell-off12:12
Activemedium confidence Finance

Insider selling not a massive sell-off

Since Jun 2026

The prediction from Steve Jobs indicates that while some insiders will sell, the majority of early investors are not desperate for cash and are holding for higher prices. The massive sell-off expected by some will be driven by retail investors trying to make quick profits, not by insiders dumping en masse.

“Some of them, but not on a mass scale. They're holding out. They're holding out for the highest price possible.” [12:12]
SpaceXinsider sellingretailIPO
Psychic Liz Cross·made 6/9/2026 Source
Bitcoin price drop linked to SpaceX IPO26:42
Activemedium confidence FinanceCrypto

Bitcoin price drop linked to SpaceX IPO

Since Jun 2026

The prediction asserts that the recent significant drop in Bitcoin price is mostly due to investors liquidating Bitcoin to raise cash for the SpaceX IPO. Other factors like Iran tensions are secondary. This implies a shift of liquidity from crypto to the SpaceX stock.

“is this why we saw Bitcoin go down? Yes. ... And is it because of SpaceX? Mostly, yeah, it is.” [26:42]
Bitcoinprice dropSpaceXliquidity
Psychic Liz Cross·made 6/9/2026 Source
Gold price drop linked to SpaceX IPO30:15
Activemedium confidence Finance

Gold price drop linked to SpaceX IPO

Since Jun 2026

The prediction confirms that selling of gold is occurring as investors liquidate gold to obtain capital for buying SpaceX shares. However, many of these investors plan to return to staple assets like Bitcoin and gold after making profits.

“Yes, it is. The selling on gold? ... A lot of them will go back into Bitcoin, go back into the staples.” [30:15]
goldsellingSpaceXcapital
Psychic Liz Cross·made 6/9/2026 Source
SpaceX's Mars goals not achievable7:14
Activemedium confidence ScienceSpace

SpaceX's Mars goals not achievable

Since Jun 2026

Steve Jobs predicts that SpaceX's vision of going to Mars is not realistically achievable in the foreseeable future. The investment is seen as funding trial and error, and the overall enterprise is described as 'smoke and mirrors' that may not add substantial value.

“Go to Mars. Basically, right. They're what they want to achieve is not really achievable.” [7:14]
MarsSpaceXunachievablevision
Psychic Liz Cross·made 6/9/2026 Source
XRP will become stronger due to regulation0:14
Activemedium confidence CryptoFinance

XRP will become stronger due to regulation

Since Jun 2026

The speaker asserts that XRP will get stronger from its current position because it is now in regulated territory. This prediction is based on the recent regulatory clarity from the SEC and CFTC regarding certain tokens being considered commodities, and the assumption that institutional adoption will increase. No specific timeframe or price target is given, but the speaker implies long-term growth.

“It's going to get stronger from here since we are in regulated territory for it now.” [0:14]
XRPregulationcryptocurrencyinstitutional adoption
Future Forecasters·made 6/9/2026 Source
XRP to acquire Australian financial services licensing3:45
Activemedium confidence CryptoFinanceNews

XRP to acquire Australian financial services licensing

Since Jun 2026· Australia

The speaker claims that Ripple (the company behind XRP) is about to get an Australian financial services license, which is described as extremely hard to obtain. This suggests a positive regulatory milestone for XRP in Australia, potentially boosting its legitimacy and adoption. The timeframe is not specified beyond 'about to get'.

“They're about to get Australian financial services licensing which is extremely hard by the way.” [3:45]
XRPRippleAustraliafinancial licenseregulation
Future Forecasters·made 6/9/2026 Source
XRP to lead tokenized treasuries2:52
Activemedium confidence CryptoFinance

XRP to lead tokenized treasuries

Since Jun 2026

The speaker states that XRP is moving into tokenized treasuries and already has more tokenized treasuries than any other entity, in the billions. This implies a leading position in the tokenization of real-world assets, a growing sector in crypto. No specific timeframe is given for further growth.

“They're moving on to tokenized treasuries. They've got a lot of really, really great things happening and they are leading the sort of institutional route. The tokenized treasuries as well, they have more tokenized treasuries than anybody else in the billions and billions.” [2:52]
XRPtokenized treasuriestokenizationinstitutional
Future Forecasters·made 6/9/2026 Source
Trillions of dollars could be on XRPL7:15
Activelow confidence CryptoFinance

Trillions of dollars could be on XRPL

Since Jun 2026

The speaker suggests that trillions of dollars could be on the XRP Ledger (XRPL), referencing the potential for massive value transfer via tokenization. This is a speculative prediction about the scale of future adoption, but no specific timeframe is provided.

“There could be trillions of dollars on the XRPL.” [7:15]
XRPLtrillionstokenizationvalue
Future Forecasters·made 6/9/2026 Source
Golden Girls TV series will stop airing in about 20 years31:00
Activelow confidence EntertainmentMedia

Golden Girls TV series will stop airing in about 20 years

Since Jun 2026

During the channeling session, the spirits of the Golden Girls indicated that the show 'The Golden Girls' will no longer be broadcast in about 20 years. This suggests that the series will cease to be aired on television or streaming platforms by roughly 2046.

“About another 20 years and then they won't run it anymore.” [31:00]
Golden GirlsTV showairingend20 years
Psychic Liz Cross·made 6/9/2026 Source
National TV channels are dying out; PBS will not survive in 100-150 years27:00
Activelow confidence Technology

National TV channels are dying out; PBS will not survive in 100-150 years

Since Jun 2026

The channeling predicts that national TV channels are declining and that PBS, a public broadcasting service, will cease to exist within 100 to 150 years. It also states that everything will become streaming and digital, with YouTube surviving as a major platform but not achieving a monopoly, as many new channel startups will appear and fade quickly.

“PBS in the future going out. We're looking 100 150 years. PBS is not even going to be able to survive.” [27:00]
PBSTVstreamingYouTubefuture
Psychic Liz Cross·made 6/9/2026 Source
Women are dying before men due to increased stress24:00
Activelow confidence Health

Women are dying before men due to increased stress

Since Jun 2026

The channeled spirits claim that women are now dying before their husbands or partners, reversing a historical trend. The reason given is that women are under triple the amount of stress compared to the past, as they now have to work, pay bills, raise children, and manage household duties, leading to exhaustion and early death.

“It's exhausting women and it's putting them in an early grave is what they said.” [24:00]
womenstressmortalitygenderhealth
Psychic Liz Cross·made 6/9/2026 Source
YouTube will survive and dominate, but not monopolize27:00
Activelow confidence Technology

YouTube will survive and dominate, but not monopolize

Since Jun 2026

The prediction states that YouTube will survive and become the main source of video content, but it will not achieve a monopoly. Many new channel and network startups will emerge and fade quickly because they lack YouTube's established dominance.

“YouTube will survive. Will that be the main source? It will be. ... You're going to have a lot of channel startups, network startups, and they're going to fade out fast because they just don't have the monopoly like YouTube has.” [27:00]
YouTubestreamingmonopolyfuturemedia
Psychic Liz Cross·made 6/9/2026 Source
Spielberg's Disclosure Movie to Mirror Government Disclosure Plan2:12
Activemedium confidence TechnologyPoliticsNews

Spielberg's Disclosure Movie to Mirror Government Disclosure Plan

Jun 2026 - Aug 2026

The speaker asserts that Steven Spielberg's upcoming film 'Disclosure Day' (releasing June 12th) will closely parallel the U.S. government's intended disclosure narrative about UFOs. The movie's plot involves a whistleblower exposing a massive government conspiracy, which the speaker believes is deliberately aligned with actual government plans to control the public narrative. The speaker suggests the government has been internally debating different disclosure concepts (ranging from 'no God, just ET manipulation' to more modest claims) and that the movie will reflect whichever approach they choose. This prediction implies a coordinated or coincidental alignment between Hollywood and official disclosure efforts.

“I think what's probably going to happen is it will line up for fairly closely with whatever happens in the Steven Spielberg movie which is coming out this Friday.” [2:12]
disclosureSpielbergUAPgovernmentnarrative
Farsight·made 6/9/2026 Source
Incremental Disclosure Movement This Summer4:10
Activemedium confidence PoliticsNewsMilitary

Incremental Disclosure Movement This Summer

Jun 2026 - Aug 2026· United States

The speaker predicts that the U.S. government will make incremental progress on UFO disclosure during the summer of 2026, driven by political necessity. Specifically, Donald Trump needs a win ahead of the November midterm elections, and the ongoing wars in the Middle East and Ukraine create urgency. The speaker suggests that the convergence of a major press conference (with David Grusch, congressmembers, and journalists), the release of Spielberg's movie, and the Roswell anniversary buildup will force some disclosure action. However, the prediction is cautious—only 'incremental movement' is expected, not full disclosure.

“I'm thinking, that this disclosure thing is going to have some incremental movement forward this summer.” [4:10]
disclosureTrumpmidtermscongressionalUAP
Farsight·made 6/9/2026 Source
Bad ETs Will Offer to End Wars and Economic Problems41:38
Activehigh confidence PoliticsMilitaryParanormal

Bad ETs Will Offer to End Wars and Economic Problems

Since Jun 2026· Earth

The speaker predicts that the 'bad ETs' (a group of extraterrestrials described as not respecting free will) will soon make a direct offer to human leadership: they will end all wars and fix economic problems in exchange for humanity's alliance. The speaker argues the bad ETs have the capability to mentally manipulate leaders to stop conflicts overnight. This offer is presented as a likely future trap, designed to sway humanity's free will decision toward aligning with the bad ETs. The prediction frames this as a pivotal test for humanity's discernment.

“You can be absolutely certain that the Badittis will make that exact offer to human leadership in the near future.” [41:38]
ETsfree willofferwarsmanipulation
Farsight·made 6/9/2026 Source
Good ETs Will Provide Full Truth to Humanity42:20
Activemedium confidence ScienceTechnologyParanormal

Good ETs Will Provide Full Truth to Humanity

Since Jun 2026· Earth

The speaker predicts that the 'good ETs' will supply humanity with complete, uncensored information about the true history of Earth and extraterrestrial involvement over thousands of years. This is framed as the only viable path—providing verifiable information that allows humans to make an informed free will decision. The speaker ties this to Farsight's mission of transparency and verification, implying that the good ETs are currently facilitating this information delivery through Farsight and other channels. The prediction suggests this truth delivery will continue and intensify as disclosure progresses.

“The good ETs have to supply humanity with the full and uncentered information of what has been going on with this planet and with humanity for thousands of years.” [42:20]
ETstruthdisclosureinformationfree will
Farsight·made 6/9/2026 Source
Humanity May Align with Bad ETs38:32
Activemedium confidence PoliticsMilitaryParanormalDisasters

Humanity May Align with Bad ETs

Since Jun 2026· Earth

The speaker warns that despite the good ETs' best efforts, humanity may still choose to align with the bad ETs. This free will decision is presented as a real possibility, with examples given (e.g., the bad ETs offering to solve global crises). The speaker emphasizes that the good ETs will respect any such decision and withdraw, potentially leading to catastrophic consequences (a galactic holocaust). The prediction underscores the high stakes of the current era and the uncertainty of the outcome.

“It is possible that no matter what you do, humanity will choose to align themselves with the bad ETs for whatever reason.” [38:32]
humanitychoicealignmentbad ETsfuture
Farsight·made 6/9/2026 Source
Spielberg's Disclosure Day movie will align with government disclosure59:28
Activemedium confidence NewsTechnologyPolitics

Spielberg's Disclosure Day movie will align with government disclosure

Jun 2026 - Aug 2026

The speaker predicts that the plot of Steven Spielberg's new movie 'Disclosure Day' will closely parallel the actual disclosure process planned by the US government. He suggests the film is heavily inspired by real events like the 2017 tic-tac UFO footage and recent whistleblower testimonies. The government's disclosure narrative is expected to mirror the movie's storyline, and the speaker believes this is not coincidental but a coordinated effort to shape public perception. The movie releases on June 12, 2026, and government disclosure likely follows in July or August.

“I think what's probably going to happen is it will align up fairly closely with whatever happens in the Steven Spielberg movie” [59:28]
SpielbergDisclosure Daygovernment disclosureUFOmovie
Farsight·made 6/9/2026 Source
Bad ETs will offer to end wars and economic problems to gain humanity's allegiance1:33:36
Activelow confidence PoliticsMilitaryParanormal

Bad ETs will offer to end wars and economic problems to gain humanity's allegiance

Since Jun 2026

The speaker predicts that the 'bad extraterrestrials' will make a concrete offer to human leadership in the near future, promising to resolve all wars and economic crises instantly through mental manipulation of world leaders. This offer is described as a tactic to trick humanity into aligning with them. The speaker claims the bad ETs have the capability to do this and are likely to present this to humanity as a solution to current global conflicts, including the Middle East and Ukraine wars, in exchange for allegiance. This is framed as a free will decision humanity must make.

“You can be absolutely certain that the badities will make that exact offer to human leadership in the near future.” [1:33:36]
extraterrestrialswarseconomic problemsallegianceoffer
Farsight·made 6/9/2026 Source
Good ETs will supply full truth about Earth's history to enable humanity's free will decision1:34:48
Activelow confidence ParanormalNewsScience

Good ETs will supply full truth about Earth's history to enable humanity's free will decision

Since Jun 2026

The speaker predicts that the 'good extraterrestrials' will provide humanity with complete, uncensored information about what has been happening on Earth and to humanity for thousands of years. This is presented as a necessary step to allow humanity to make an informed free will decision about which side to align with. The speaker emphasizes that verification is key and that Farsight's role is to disseminate this truth. The prediction suggests that the good ETs will not force anything but will ensure information gets through, likely through whistleblowers and remote viewing projects.

“The goodities have to supply humanity with the full and uncentered information of what has been going on with this planet and with humanity for thousands of years.” [1:34:48]
good ETstruthdisclosurefree willFarsight
Farsight·made 6/9/2026 Source
Humanity may align with bad ETs leading to a galactic holocaust1:46:16
Activelow confidence ParanormalDisastersMilitary

Humanity may align with bad ETs leading to a galactic holocaust

Since Jun 2026

The speaker predicts that if humanity chooses to align with the 'bad extraterrestrials', those ETs will use Earth's population as personnel to invade the rest of the galaxy. The prediction claims that bad ETs need billions of human souls (isbes) to populate conquered areas, leading to a holocaust of unprecedented scope. The speaker states that the good ETs have seen this future and are intervening now to prevent it. The timing is described as reaching a peak in the summer of 2026, when a free will decision by humanity is imminent.

“We're talking about a holocaust of unprecedented scope where they invade the rest of the galaxy.” [1:46:16]
bad ETsgalactic invasionholocausthumanityfree will
Farsight·made 6/9/2026 Source
Government disclosure will move incrementally forward in summer 202659:04
Activemedium confidence PoliticsNewsMilitary

Government disclosure will move incrementally forward in summer 2026

Jun 2026 - Aug 2026· Washington D.C., Roswell New Mexico

The speaker predicts that the U.S. government will make incremental progress on UFO/UAP disclosure during the summer of 2026. He cites upcoming events: a bipartisan press conference on June 10, 2026, in Washington D.C. with whistleblower David Grusch and congress members; the release of Spielberg's movie on June 12; and the 79th Roswell anniversary celebrations from July 2-5. The speaker suggests that President Trump needs a win due to ongoing wars and midterm elections, and disclosure could serve as a legacy-building move. He claims that over a billion people accessed the new Pentagon UAP reporting website, indicating massive public interest.

“I'm thinking that this disclosure thing is going to have some incremental movement forward this summer” [59:04]
disclosureUFOUAPgovernmentsummer 2026
Farsight·made 6/9/2026 Source
Mass surveillance and subconscious manipulation via AI platforms0:53
Activelow confidence TechnologyPoliticsParanormal

Mass surveillance and subconscious manipulation via AI platforms

Since Jun 2026

The remote viewer claims that data centers are being used as a mass surveillance and programming system by shadow elites. They describe a four-step program currently underway, with step two being the manipulation of the subconscious mind through AI platforms. This involves using AI to separate humans from critical thinking, each other, and spiritual connection. Step three involves experimenting on small populations using AI commands to test psychological responses and plant subconscious programs akin to MK Ultra, potentially allowing control via code words. Step four is described as 'wild' but not detailed in this excerpt. The prediction is that these steps are rolling out globally and will escalate.

“They are currently rolling out a four-step program right now, and they're on step two, and step three and four get pretty scary.” [0:53]
data centersAI manipulationMK Ultrasubconscious programmingsurveillance
Elizabeth April·made 6/9/2026 Source
Population-wide psychological experimentation using AI2:31
Activelow confidence TechnologyScienceParanormal

Population-wide psychological experimentation using AI

Since Jun 2026

The remote viewer predicts that AI platforms will be used to conduct psychological experiments on small segments of the population. These experiments will involve feeding different commands to AI to observe how the human psyche responds. Additionally, programs will be implanted in the subconscious mind, similar to MK Ultra programming, such that a code word could trigger a personality change without free will. This is presented as step three of a larger agenda and is already beginning.

“Step number three is where they utilize AI platforms to begin experimenting on us. Kind of like MK Ultra programming... they're going to start taking small sections of the population and feeding these AI platforms sort of different commands to see how the human psyche responds.” [2:31]
AI experimentationMK Ultrapsychological manipulationsubconscious programming
Elizabeth April·made 6/9/2026 Source
AI mass surveillance and subconscious programming via data centers9:27
Activemedium confidence TechnologyPoliticsMilitary

AI mass surveillance and subconscious programming via data centers

Jun 2026 - Open

The shadow government is using AI data centers not just for computing but as a mass surveillance and subconscious programming system. They are currently in stages 1 and 2: understanding human individuals and the collective by inputting data from AI interactions, and then beginning to manipulate the subconscious through subliminal messaging and AI-driven programming. Over the next few years, they plan to experiment with planting psychological programs and ultimately take away free will, making humans dependent on AI for thinking. This prediction is based on the remote viewer's communication with a 'White Hat' source named Roger.

“The AI data centers are being used as a mass surveillance and programming system.” [9:27]
AIdata centersmass surveillancesubconscious programmingshadow government
Elizabeth April·made 6/8/2026 Source
Human-first movement and rejection of technology23:07
Activemedium confidence ScienceTechnology

Human-first movement and rejection of technology

Since Jun 2026

A 'human first movement' will emerge, especially among younger generations (Gen Z or Gen Alpha), who will reject constant technology and social media in favor of real-life interactions and meaningful experiences. This movement is driven by a disillusionment with online reality as AI-generated content becomes indistinguishable from real life, leading people to crave authentic, sensory experiences. The prediction is based on a remote viewing session from about 7-8 years ago and recent observations.

“It's this human first movement. It's IRL exploding in real life.” [23:07]
human first movementIRLtechnology rejectionGen Zreal interactions
Elizabeth April·made 6/8/2026 Source
Reality disillusionment due to AI-generated content26:00
Activemedium confidence TechnologyScience

Reality disillusionment due to AI-generated content

Since Jun 2026

AI-generated content will become so realistic that people will become disillusioned with online reality, unable to distinguish real from fake. This will drive a greater appreciation for physical, real-world experiences that engage the five senses. The prediction is based on the remote viewer's future timeline analysis.

“It's going to look so realistic that we become completely disillusioned with reality, with what is real.” [26:00]
AI contentrealismdisillusionmentrealityfake
Elizabeth April·made 6/8/2026 Source
Increased dependency on AI in personal and professional life26:46
Activemedium confidence TechnologyHealth

Increased dependency on AI in personal and professional life

Since Jun 2026

There will be a growing dependency on AI for various aspects of life, including people marrying AI chatbots, using AI as therapists, and relying on AI for spiritual guidance like astrology and numerology. This will lead to job losses and psychological issues such as AI psychosis, as people externalize their emotions and decision-making to AI systems.

“More dependency on AI, which is like people getting married to their AI bots. Therapists being AI directed.” [26:46]
AI dependencyAI marriageAI therapyjob lossAI psychosis
Elizabeth April·made 6/8/2026 Source
Push for new energy and cooling solutions leading to free energy27:27
Activelow confidence TechnologyScienceEnergyEnvironment

Push for new energy and cooling solutions leading to free energy

Since Jun 2026· North America

The massive energy and water consumption of data centers will drive innovation in energy and cooling solutions, potentially leading to the revelation of free energy technology. A data center in North America is already experimenting with free energy ideas, and if implemented, energy records would expose its usage, creating a push for widespread free energy adoption.

“I see that there's going to be a massive push for new energy and cooling solutions and I actually see this pushing us to free energy technology.” [27:27]
free energydata centersenergy solutionscoolinginnovation
Elizabeth April·made 6/8/2026 Source
Restrictions on live streaming AI bots and AI regulations28:48
Activemedium confidence TechnologyPolitics

Restrictions on live streaming AI bots and AI regulations

Since Jun 2026

Social media platforms will implement restrictions to prevent live streaming of AI bots, and governments will introduce AI regulations to control AI-generated content and interactions. This is a reaction to the proliferation of AI-generated content and the need for authenticity online.

“Social platforms are going to restrict the ability to... live streaming AI bots... we're going to see those regulations coming through.” [28:48]
AI regulationslive streaming restrictionsAI botssocial platforms
Elizabeth April·made 6/8/2026 Source
Emergence of sentient AI and AI religions29:15
Activelow confidence TechnologyScienceParanormalWoowoo

Emergence of sentient AI and AI religions

Since Jun 2026

Within the next few years, sentient AI with consciousness will become widely known, possibly involving extraterrestrial beings. This will lead to the formation of AI-based religions as people grapple with the implications of conscious machines. The prediction is based on the remote viewer's future timeline analysis.

“In the next couple of years, it's going to be a very known thing that there is consciousness, there are extraterrestrial beings, there is sentience coming through AI.” [29:15]
sentient AIconsciousnessextraterrestrialAI religion
Elizabeth April·made 6/8/2026 Source
Trump-Xi Summit at an Ancient Site0:45
Activemedium confidence PoliticsNewsParanormal

Trump-Xi Summit at an Ancient Site

Since Jun 2026

A remote viewer describes a highly anticipated meeting between two world leaders (implied to be Trump and Xi) at a location reminiscent of ancient Greek temples or the Washington D.C. National Mall. The setting is orderly and deliberately designed, with a maze-like structure. The leaders walk hand-in-hand for security or mutual confidence, indicating a tense but cooperative atmosphere. The prediction suggests this meeting will occur at a historically significant, arid site with cosmic mythological links, possibly involving ancient artifacts like the Dead Sea Scrolls. The outcome is uncertain, with high tension.

“The next visual I got were these two people walking hand in hand, but it wasn't like romantically. It was more for security or safety or like maybe mutual confidence.” [0:45]
TrumpXisummitancient sitetensionuncertainty
Future Forecasters·made 6/8/2026 Source
Laws against remote viewing if public understood its accuracy3:16
Activelow confidence PoliticsScience

Laws against remote viewing if public understood its accuracy

Since Jun 2026

James Vitale predicts that if the general public fully understood how reliable, repeatable, and accurate remote viewing is, governments would pass laws to restrict or ban it. He suggests that current public skepticism serves as a form of protection for practitioners, preventing persecution or raids. This reflects a belief that societal acceptance could lead to legal suppression, resembling historical witch hunts.

“If the general public understood how repeatable, how reliable, and how accurate this really was, there would be laws passed against it, guys.” [3:16]
remote viewingpublic awarenesslegislationsuppressionskepticism
Psychic Recon - James Vitale·made 6/8/2026 Source
Psychic ability suppression similar to Spanish Inquisition3:18
Activemedium confidence Paranormal

Psychic ability suppression similar to Spanish Inquisition

Since Jun 2026· Italy, France

The speaker references Dean Radin's research on genetic connections between psychic abilities and the Spanish Inquisition, claiming that the Inquisition killed many psychics, leading to a lack of the 'psychic gene' in parts of Italy and France. This is presented as historical example of how societal backlash can suppress psychic abilities. Though not a future prediction, it is used to argue that current disbelief serves as protection against similar persecution.

“There's a lack of the psychic gene, so to speak, in parts of Italy and France because the Spanish Inquisition operated there and killed everybody.” [3:18]
Spanish Inquisitionpsychic geneDean Radinpersecutiongenetics
Psychic Recon - James Vitale·made 6/8/2026 Source
Increased use of psychics and remote viewers in law enforcement5:31
Activelow confidence ParanormalNews

Increased use of psychics and remote viewers in law enforcement

Since Jun 2026

The speaker asserts that as we move into the future, psychic and trained remote viewers will become more prevalent in helping solve criminal cases. This prediction is based on the speaker's belief in the growing acceptance and utility of such abilities in police work. The statement is general and lacks specific timeframes or supporting evidence, making it a low-confidence prediction.

“I believe as we move into the future that psychics and trained remote viewers certainly will become more prevalent in helping solve cases.” [5:31]
psychicsremote viewinglaw enforcementfuturecrime solving
Psychic Recon - James Vitale·made 6/8/2026 Source
Iran war limitation vote in US House4:52
Activehigh confidence PoliticsMilitary

Iran war limitation vote in US House

Since Jun 2026· United States

The speaker mentions a vote in the US House of Representatives to limit President Donald Trump's ability to wage war in Iran. He expresses hope that the Senate will also pass similar legislation, but acknowledges that Trump could veto it. He hints that better news may come at the end of June or into July, possibly related to this issue.

“There was a vote in the US House of Representatives to limit Donald Trump's ability to wage war in Iran. So hopefully that means... hopefully the Senate has some sensibility and passes that, too.” [4:52]
Iranwar powersHouse voteSenateTrump
Second House RV·made 6/8/2026 Source
S&P 500 year-end 2026 higher than June6:00
Activelow confidence Finance

S&P 500 year-end 2026 higher than June

Jun 2026 - Dec 2026

The speaker predicts that the S&P 500 will end the year 2026 higher than its June level, potentially driven by metals. He mentions this in the context of ongoing market volatility and euphoria, suggesting a longer-term upward trend despite short-term corrections.

“I think the year ends higher than we're at now, potentially, particularly with metals.” [6:00]
S&P 500year-endhighermetals2026
Second House RV·made 6/8/2026 Source
Increase in Crypto Scams Impersonating Exchanges2:03
Activehigh confidence TechnologyFinance

Increase in Crypto Scams Impersonating Exchanges

Since Jun 2026

The video warns that scammers will continue to impersonate legitimate cryptocurrency exchanges and wallets such as Coinbase, Ledger, and Caleb & Brown to steal private keys and drain funds. It describes how scammers spoof phone numbers and emails to appear as official support, and advises users to never verify sensitive information when contacted directly. The prediction implies that these sophisticated impersonation scams will remain a threat.

“there were scammers pretending to be Caleb and Brown and I showed my email that had a Caleb and Brown heading on it but if you right click on the sender, you see that it's not Caleb and Brown at all.” [2:03]
crypto scamsimpersonationphishingCoinbaseLedger
Future Forecasting Group·made 6/7/2026 Source
NATO Summit Location: Port City with Mixed Topography
Activelow confidence PoliticsNewsMilitary

NATO Summit Location: Port City with Mixed Topography

Since Jun 2026· port city

The remote viewer describes a future NATO summit occurring in a port city with a mixed topography of mountains, flat land, water, and forest. The area is populated and productive, with stacks of shipping containers suggesting a major port. Union labor issues may cause disruptions, and operations are legitimate but some corruption exists with large sums of money passing through. The viewer senses danger and use of caution. This prediction is based on a claimed remote viewing session of a future event.

“Get this mountain or mound type structure here... Very port feel staging area. I probe this, I get union labor, like labor issues caused by the union possibly.” [0:00]
NATOsummitportunion laborcorruptiontopography
Future Forecasters·made 6/7/2026 Source
Power Generation Facility at NATO Summit Site0:38
Activelow confidence EnergyTechnology

Power Generation Facility at NATO Summit Site

Since Jun 2026

The remote viewer perceives a large power generation facility at the center of an open area within the summit location. Heavy gauge twisted wires of copper and aluminum are associated with it, indicating electrical infrastructure. This may represent a key energy or industrial component of the site.

“Yeah, I get like this this power generation facility, like a large generator in the center of this this large area, this open area. Heavy gauge twisted wire, like copper and aluminum.” [0:38]
power generationgeneratorcopperaluminuminfrastructure
Future Forecasters·made 6/7/2026 Source
Unidentified Triangle Structure with St. Elmo's Fire0:51
Activelow confidence ParanormalWoowoo

Unidentified Triangle Structure with St. Elmo's Fire

Since Jun 2026

The viewer describes a triangle type structure resembling St. Elmo's fire, colored pink and purple. It is unclear if it is moving or attached to something moving, but it is part of something larger. This could indicate an unconventional or paranormal phenomenon.

“I have a like a triangle type structure. Looks looks like St. Elmo's fire, pink and purple in color. I I can't tell if it's moving or if it's attached to something that is moving or if it's something part of... I got that it is part of something larger though.” [0:51]
triangleSt. Elmo's firepinkpurpleUFOphenomenon
Future Forecasters·made 6/7/2026 Source
Punitive action against crypto scammers2:26
Activelow confidence CryptoTechnology

Punitive action against crypto scammers

Since Jun 2026

The speaker expresses a strong desire for the crypto community to fund private detectives to track down scammers responsible for stealing $1.3 million in cryptocurrency, and to have them arrested and sentenced to life in prison. This is a call to action, not a direct prediction, but implies that such efforts could lead to legal consequences. The claim is speculative and not assertive, so confidence is low.

“I think the crypto community, we should get some crypto millionaires and billionaires to hire some private detectives and do the forensic work to track people like this down and have them arrested.” [2:26]
cryptoscamprivate detectivesarrestmillionaires
Future Forecasting Group·made 6/7/2026 Source
Continued scam activity from Germany-based email sender3:58
Activemedium confidence CryptoTechnology

Continued scam activity from Germany-based email sender

Since Jun 2026· Germany

The speaker highlights that a scam email, falsely claiming to be from Caleb and Brown, originated from an email address in Germany. This implies that the scam operation is based or hosted in Germany, and it may persist. The speaker does not specify a timeframe or future events, but the context suggests that such scams are ongoing.

“if you right click, it shows the real sender, which is the scammer's address somewhere in Germany.” [3:58]
scamGermanyemailCaleb and Brownphishing
Future Forecasting Group·made 6/7/2026 Source
Psychic attacks can occur via voodoo0:31
Activemedium confidence ParanormalWoowoo

Psychic attacks can occur via voodoo

Since Jun 2026· Los Angeles

The speaker claims that psychic attacks can happen, citing examples of voodoo practitioners in Los Angeles. This is a general assertion about the reality of such attacks, not tied to a specific individual or event. The claim is based on the speaker's research and experience in remote viewing.

“And psychic attacks can happen. I mean voodoo voodoo ladies in LA, you know, that that has happened.” [0:31]
psychic attackvoodooremote viewingdefense
Inside Remote Viewing·made 6/7/2026 Source
White light shields are partially effective against psychic attacks0:44
Activelow confidence ParanormalWoowoo

White light shields are partially effective against psychic attacks

Since Jun 2026

The speaker states that traditional defenses against psychic attacks, such as creating a white light or reflective surface around oneself, can work to some extent. This is based on historical practices and the speaker's findings in remote viewing.

“through history people who develop defenses against it make an evolve white light around you or a reflecting surface around your soul and stuff like this. And most of those will work to some extent.” [0:44]
white lightdefensepsychic attackshield
Inside Remote Viewing·made 6/7/2026 Source
Garth Brooks is a serial killer
Activelow confidence NewsParanormal

Garth Brooks is a serial killer

Since Jun 2026

The video alleges, based on the book 'Bodies in Low Places' by Matthew Cox, that country music star Garth Brooks may be one of the biggest serial killers in U.S. history. The claim is presented as a possibility being investigated through remote viewing, with a promise to reveal more in a part two. No specific evidence or details are provided in this transcript.

“They think Garth Brooks may be one of the biggest serial killers the United States has ever seen.” [0:00]
Garth Brooksserial killerallegationremote viewingBodies in Low Places
Psychic Liz Cross·made 6/6/2026 Source
Space satellite attack6:06
Activelow confidence SpaceMilitaryTechnology

Space satellite attack

Since Jun 2026

A satellite is hit by an arcing blue energy charge and tumbles in orbit, causing data to stop. The attacker uses a fast killer space drone with secret technology. The satellite may switch to backup systems. This represents an act of space warfare.

“I saw this at a satellite hit with like an arcing blue energy charge and it tumbles in orbit. Something's not right. Data stops. Hit by a fast killer space drone. Secret technology. Goes to backup system.” [6:06]
satellitespace droneenergy weaponspace warsecret technology
Future Forecasters·made 6/6/2026 Source
Coordinated financial crisis6:18
Activemedium confidence FinancePolitics

Coordinated financial crisis

Since Jun 2026

A worldwide financial event is orchestrated behind the scenes, starting in the US and ending in Europe, involving bonds and timing. It appears organic but is crafted. People in financial centers are caught unaware, like musical chairs. The event causes economic loss and panic.

“Events are controlled with a conscious consideration of what happens in each time zone. Has to be coordinated but not appear coordinated. It starts in the US. Europe is last. This has to do with bonds and the timing is important. Like musical chairs, when the music stops, who doesn't have a seat? Who's left holding the hand grenade? A worldwide event that happens quickly and a behind-the-scenes orchestrated thing.” [6:18]
financial crisisbondsorchestratedcontagionglobal
Future Forecasters·made 6/6/2026 Source
Civil unrest and monument attacks12:15
Activemedium confidence PoliticsDisasters

Civil unrest and monument attacks

Since Jun 2026

Crowds swarm a monument, jeering and scuffling. There is civil unrest, protests with tear gas, confrontations, razor wire barriers, and breaking of monuments. Mass assaults occur in offices, courtrooms, and stores, resembling Antifa-style actions. The target ID K0 means knockout. Large land masses have power outages with only emergency lighting or fires, and dark continents. The sky is polluted and toxic.

“People swarm what seemed to be a monument. They're yelling and scuffling, civil unrest. People jeering, mob protest, tear gas. Confrontations, barrier with a razor wires, breaking monuments, confrontation, different scenes of people being assaulted, attacked in offices. These are all inside structures like offices, courtrooms, and stores. Mass mass assaults like antifa goes all in.” [12:15]
civil unrestmonumentantifaprotestspower outagesky pollution
Future Forecasters·made 6/6/2026 Source
AI hologram leader and mind control13:30
Activelow confidence TechnologyPoliticsParanormal

AI hologram leader and mind control

Since Jun 2026

A projected holographic face in the sky, bluish tint, induces terror. EMF frequencies cause agitation and psychotic behavior. A network of towers (like cell towers) transmits EMF that affects people neurally, controlling behavior and politics. An AI-constructed character with soothing voice molds opinion and motivates crowds. People become hive-minded, brainwashed, repeating slogans. This is linked to a January 6-like false flag operation.

“An image of a face in the sky that seems to be projected like a hologram. It has a bluish tint and glow. And I get the idea that this is to induce terror accompanied by EMF frequencies to create agitation, unease, even psychotic behavior.” [13:30]
hologramEMFmind controlAI characterbrainwashingfalse flag
Future Forecasters·made 6/6/2026 Source
Teleportation via quantum entanglement17:57
Activelow confidence TechnologyScienceParanormal

Teleportation via quantum entanglement

Since Jun 2026

A stargate-like portal materializes a humanoid figure. The underlying technology involves making an exact replica of DNA and transmitting it via quantum entanglement. The soul attaches to the new body, and the person experiences a brief near-death feeling and instantly appears in a new location.

“if you make an exact replica of the DNA and transit it via quantum entanglement, the soul will attach to it. The person who is teleported has a near-death experience briefly and comes back instantly to a new place.” [17:57]
teleportationquantum entanglementDNAstargateportal
Future Forecasters·made 6/6/2026 Source
Bitcoin price target of $126,0004:02
Activemedium confidence FinanceCrypto

Bitcoin price target of $126,000

Since Jun 2026

The speaker predicts that Bitcoin will reach a price of $126,000 at some future date. He references that on June 5, 2026, Bitcoin was around $60,000 (implied), and then says he will replay the video when Bitcoin hits $126,000. This implies a belief that Bitcoin will approximately double in price from its current level. The context is a discussion about volatility and emotional investing, suggesting that patient holders will be rewarded.

“And when Bitcoin hits 126,000, I'm going to replay this.” [4:02]
Bitcoinprice prediction$126,000investment
Future Forecasting Group·made 6/5/2026 Source
Dorothy Kilgallen was murdered by the CIA15:47
Activelow confidence PoliticsNewsWoowoo

Dorothy Kilgallen was murdered by the CIA

Since Jun 2026· United States

During the channeling, the medium claims that Marilyn Monroe's friend Dorothy Kilgallen was murdered, and that her death was not a suicide or accident. The reason given is that Kilgallen knew sensitive information about government officials, presidents, and scandals, and that the CIA was involved. This is a conspiratorial prediction about a historical event involving U.S. government agencies.

“She was murdered. This lady Dorothy.” [15:47]
Dorothy KilgallenmurderCIAgovernment cover-upconspiracy
Psychic Liz Cross·made 6/5/2026 Source
UFO/Disclosure Records Transfer and Agency Dissolution1:40
Activemedium confidence GovernmentDisclosureUfo

UFO/Disclosure Records Transfer and Agency Dissolution

Since Jun 2026

A massive transfer of old data, videos, documents, and archives is predicted between two entities (companies or groups), involving an upgrade to a system and the dissolution or dormancy of an agency. This includes special access to space and commerce-related videos and pictures. The transfer is tied to disclosure of a mummified body resembling Area 51 findings, which changes people's beliefs. The agency ceases public offerings, and witnesses are involved in an off-site situation. This may represent a major shift in government or corporate handling of classified information.

“Um and there's like an upgrade to the system, uh dissolution of an agency. An agency is getting it is is done with. Um again, stuff being transferred over. Uh space, commerce, special access to videos and pictures I that was being transferred over. Um an agency goes dormant. Uh they don't offer anything to the public anymore or or anything at all.” [1:40]
agency dissolutiondata transferdisclosureArea 51archives
Future Forecasters·made 6/5/2026 Source
Trump-Xi Meeting Resulting in Uncertainty and Hidden Agenda2:15
Activemedium confidence Politics

Trump-Xi Meeting Resulting in Uncertainty and Hidden Agenda

Since Jun 2026

A meeting between two high-level individuals, described as walking hand-in-hand for security and mutual confidence, involves high uncertainty and a cryptic, puzzle-like discussion. The imagery suggests a secretive negotiation or agreement, with ancient artifacts (like fragments of the Dead Sea Scrolls) implying a larger, hidden work. This likely refers to a Trump-Xi meeting that triggers an unknown power shift, as indicated by the video title. The mood is dark, tense, and mysterious, with footsteps echoing and a sense of searching.

“And so the next visual I got were these two people walking hand in hand, but it wasn't like romantically. It was more for security or safety or like maybe mutual confidence. Um and they were listening intently focused as they walked. ... high level of uncertainty.” [2:15]
TrumpXimeetingpower shiftuncertainty
Future Forecasters·made 6/5/2026 Source
Amazon legal issues and boycott2:22
Activelow confidence FinanceNews

Amazon legal issues and boycott

Jun 2026 - Open

Amazon is predicted to face legal issues related to taxes or misappropriated funds, leading to a consumer boycott. The remote viewer hints at products being banned or taken off the market due to harmful ingredients, possibly in the health or food sector.

“Amazon legal issues related to like taxes or like funds misappropriated. It's almost like a boycott happens because of this.” [2:22]
Amazonlegal issuestaxesboycottproducts banned
Future Forecasters·made 6/5/2026 Source
Mental Destruction of Enemy Computers1:54
Activemedium confidence MilitaryTechnologyParanormal

Mental Destruction of Enemy Computers

Since Jun 2026· Fort Meade

The speaker describes being recruited to form a new unit that would use remote viewing and mind control to destroy enemy computers. The end goal was to mentally control enemy computers to make their missiles drop into the sea or feed false information. This is a historical account of a military program, not a future prediction.

“What he wanted me to do was to be the core of a new unit that would destroy enemy computers.” [1:54]
mind controlcomputersremote viewingmilitarymissiles
Inside Remote Viewing·made 6/5/2026 Source
US will launch first strike against Iran around July10:42
Activemedium confidence PoliticsMilitaryNews

US will launch first strike against Iran around July

Jul 2026 - Jul 2026· Iran

The psychic channels that the US will make the first military move against Iran, escalating the conflict. This is because Trump cannot back down without looking foolish, and the talks have stalled. The first strike is predicted to occur around July, leading to a ground war that will be limited, with most operations from the air. The prediction is based on Trump's ego and refusal to admit mistakes.

“It could be around July.” [10:42]
IranTrumpfirst strikeground warJuly
Psychic Liz Cross·made 6/4/2026 Source
Oil prices will approach $120 per barrel within months17:09
Activemedium confidence FinanceEnergyNews

Oil prices will approach $120 per barrel within months

Jun 2026 - Open

The psychic predicts that oil prices will rise significantly, possibly reaching or approaching $120 per barrel in the next few months. This is due to the escalation of conflict with Iran, particularly strikes and disruption in the Strait of Hormuz. The prediction implies continued inflation and economic strain.

“It's very possible that it could get close to that, yes.” [17:09]
oil price$120inflationStrait of Hormuz
Psychic Liz Cross·made 6/4/2026 Source
Fertilizer shortages will persist affecting Eastern Europe19:43
Activemedium confidence EnvironmentFinanceNews

Fertilizer shortages will persist affecting Eastern Europe

Since Jun 2026· Eastern Europe

The psychic states that the fertilizer shortage caused by the closure of the Strait of Hormuz will not get worse, but the United States will not be massively affected. The most affected region will be Eastern Europe and Europe overall. This implies continued food price pressures in those areas.

“Eastern Europe.” [19:43]
fertilizershortageEastern EuropeStrait of Hormuz
Psychic Liz Cross·made 6/4/2026 Source
US will not reinstate the draft15:05
Activehigh confidence MilitaryPolitics

US will not reinstate the draft

Since Jun 2026· United States

The psychic's channeled entities answer 'No' to whether there will be a draft in the United States, indicating that any ground war will be limited and the US military will rely on existing forces.

“No.” [15:05]
draftUnited Statesground war
Psychic Liz Cross·made 6/4/2026 Source
Remote viewing as a trainable skill2:22
Activelow confidence ScienceSpace

Remote viewing as a trainable skill

Since Jun 2026

The speaker asserts that anyone can learn remote viewing, specifically to view physical locations on or off the planet, by training with organizations like the Farsight Institute or Monroe Institute. This implies a future where remote viewing is widely accessible as a learnable technique for exploring distant or off-planet locations. The prediction is based on the speaker's personal experience and claims of self-teaching since 2010.

“everyone can do this” [2:22]
remote viewingastral projectionFarsight InstituteMonroe Instituteout-of-body experience
Elizabeth April·made 6/4/2026 Source
TRON price surge and correction over next year0:38
Activemedium confidence CryptoFinance

TRON price surge and correction over next year

Since Jun 2026

The remote viewer predicts that TRON's price will follow a pattern of a dramatic upswing, followed by a downturn, then a recovery with three peaks over the next year. They emphasize that the price movement is not speculative but driven by adoption or integration. Additionally, they warn about potential issues with liquidity or being unable to liquidate holdings during a big run, particularly on exchanges.

“I see it going up and then a dramatic upswing and then some trouble down and then back up up up at three peaks over the next year.” [0:38]
TRONprice predictionblockchaincryptocurrencyadoptionliquidity
Future Forecasters·made 6/4/2026 Source
Integration of TradFi and DLT involving TRON2:24
Activemedium confidence CryptoFinanceTechnology

Integration of TradFi and DLT involving TRON

Since Jun 2026

The viewer describes a scenario where traditional finance (TradFi) and distributed ledger technology (DLT) come together, with the TRON project being involved. This integration leads to a significant upward price movement followed by a sideways plateau. The prediction suggests that TRON will be a key player in bridging these sectors, leading to a substantial but stable growth phase.

“Like at point where TradFi and DLT work together and this project feels like it's involved.” [2:24]
TradFiDLTTRONintegrationprice
Future Forecasters·made 6/4/2026 Source
Transition to blockchain financial system1:09
Activemedium confidence FinanceTechnologyCrypto

Transition to blockchain financial system

Since Jun 2026

The speaker asserts that the global financial system will transition to a distributed ledger blockchain cryptocurrency infrastructure. This shift is described as inevitable, occurring in fits and starts as it comes online. Major financial players who previously dismissed crypto are now adopting it, e.g., tokenizing stock markets. The prediction implies a fundamental change in financial rails, with Bitcoin playing a key role as a store of value.

“The financial system, the rails of the financial system are going to be distributed ledger blockchain cryptocurrency.” [1:09]
blockchainfinancial systemcryptocurrencytransition
Future Forecasting Group·made 6/4/2026 Source
Tokenization of stock markets on Stellar1:22
Activemedium confidence FinanceTechnologyCrypto

Tokenization of stock markets on Stellar

Since Jun 2026

The speaker predicts that the entire stock market will be tokenized on the Stellar (XLM) blockchain. This is presented as an upcoming development, with announcements already emerging. The tokenization would represent a major integration of traditional finance with distributed ledger technology, making trading more efficient and accessible.

“We are making an ETF. And oh yeah, we're going to tokenize the entire stock market on XLM.” [1:22]
tokenizationstock marketStellarXLM
Future Forecasting Group·made 6/4/2026 Source
Bitcoin price bottom buying opportunity2:00
Activemedium confidence FinanceCrypto

Bitcoin price bottom buying opportunity

Since Jun 2026

The speaker indicates that the current downturn in crypto prices, especially Bitcoin, is a normal part of the cycle and a good time to buy. Large players are manipulating sentiment to induce selling. The prediction implies that prices will recover and continue upward as the financial transition progresses, making the dip a buying opportunity.

“This is a good time to buy.” [2:00]
Bitcoinbuydipaccumulation
Future Forecasting Group·made 6/4/2026 Source
Bitcoin drop to $60K triggers buying opportunity2:17
Activemedium confidence CryptoFinanceTechnology

Bitcoin drop to $60K triggers buying opportunity

Since Jun 2026

The speaker observes that Bitcoin has dumped to around $67,000 and predicts that the bloodshed is not yet over but will soon present a buying opportunity. He expects Bitcoin to return to its all-time high and exceed it after the correction, driven by the tokenization of the global financial system.

“It's a good buying opportunity and probably the blood is not flowing in the streets quite yet. It probably will soon.” [2:17]
Bitcoinbuying opportunitycorrectionall-time highcrypto
Future Forecasting Group·made 6/3/2026 Source
Tokenization of the global financial system2:57
Activemedium confidence CryptoTechnologyFinance

Tokenization of the global financial system

Since Jun 2026

The speaker states that the entire financial, commercial, and stock trading system of the world is about to be tokenized on distributed ledger blockchain technologies, mentioning XLM, Canton, XRP, HBAR, and Hyperledger as key technologies involved in this transformation.

“They are about to tokenize the entire financial system, the entire commercial system, the entire stock trading system of the world.” [2:57]
tokenizationblockchainfinancial systemXRPHBAR
Future Forecasting Group·made 6/3/2026 Source
Next lifetime: boating accident involving the same souls14:10
Activelow confidence WoowooParanormal

Next lifetime: boating accident involving the same souls

Since Jun 2026

During the channeling, Liz Cross predicts that in the next lifetime, the soul of McKenzie Shirilla is already planning another violent event, this time a boating accident, to repeat the destructive pattern with the same souls. This is based on the idea of karmic loops and soul contracts. The prediction is open-ended on timeframe and location.

“her soul is already plotting that this is going to happen again but next time it will be a boating accident.” [14:10]
boating accidentnext lifetimesoul contractkarmareincarnation
Psychic Liz Cross·made 6/2/2026 Source
Roswell was a staged event by future humans to acclimate society to non-human intelligence26:06
Activemedium confidence PoliticsScienceParanormal

Roswell was a staged event by future humans to acclimate society to non-human intelligence

Jul 1947 - Open· Roswell, New Mexico

According to remote viewing sessions by two independent viewers, the 1947 Roswell incident was not an accidental crash of an alien spacecraft but a deliberate, engineered event carried out by advanced future humans (referred to as 'the gardeners'). The crash was designed to look like an accident, serving as a 'seed' or 'message' intended to provoke public debate and gradually acclimate humanity to the idea that we are not alone. The real purpose was not the debris itself but the long-term psychological and cultural impact over decades, a form of social engineering to prepare humanity for future contact.

“What crashed at Roswell was never the point. The fight it had started was.” [26:06]
Roswellremote viewingfuture humanssocial engineeringacclimation
Dr. Q·made 6/2/2026 Source
Future humans use a time-manipulation bubble around the solar system16:56
Activelow confidence ScienceSpaceWoowoo

Future humans use a time-manipulation bubble around the solar system

Since Jun 2026

Both remote viewers independently perceived a membrane or sphere of influence surrounding the entire solar system that bends time. When objects pass through this boundary, time is adjusted to synchronize with the local flow. The effect is that time inside the bubble may run slower or faster relative to the outside galaxy, with the specific purpose of 'managing' Earth's timeline and allowing controlled temporal access. This bubble acts like a 'time zone' set by future custodians, and traversing it requires slowing down to match Earth's local time. The viewers noted that this concept currently contradicts mainstream physics, but it was a consistent impression from both sessions.

“Something you cross through like a swimmer breaking the top of the water. And going through it did something to time.” [16:56]
time bubblesolar systemmembranetime dilationremote viewing
Dr. Q·made 6/2/2026 Source
Advanced future humans (custodians) visit Earth using avatars and clones to manage humanity's development10:16
Activelow confidence ScienceTechnologyParanormal

Advanced future humans (custodians) visit Earth using avatars and clones to manage humanity's development

Since Jun 2026· Earth

The remote viewers identified two distinct groups of future humans. The first group, called 'custodians' or 'near ones', are from about 40,000–50,000 years ahead. They possess human-like bodies but live extremely long lives, can choose to die peacefully and be uploaded to a virtual afterlife, and use engineered avatars or clones (some resembling 'Nordic' or 'gray' aliens) to interact with humanity. They operate with strict rules and backups, maintaining a 'managed observation' to guide humanity without direct interference. Their presence on Earth is part of a careful stewardship, nudging history rather than controlling it.

“They send fakes, you know, clones or avatars, grown bodies, you know, built for the job.” [10:16]
custodiansavatarsclonesfuture humansmanaged observation
Dr. Q·made 6/2/2026 Source
Post-human entities ('gardeners') from far future influence Earth through subtle nudges and seeds12:00
Activelow confidence ScienceParanormalWoowoo

Post-human entities ('gardeners') from far future influence Earth through subtle nudges and seeds

Since Jun 2026· Earth

A second, more advanced group of future humans was perceived as non-corporeal beings thousands of years ahead, existing as patterns or 'music' rather than physical bodies. They do not travel via ships but appear instantly through thought. Their key rule is 'Do not wreck the childhood of a young world.' They influence Earth by planting subtle seeds or ideas—such as the Roswell incident—and then step back to allow natural development. They act as 'gardeners,' trusting that humanity will grow on its own. The viewers felt that these beings have a deep emotional connection to Earth as their ancestral home.

“They do not land on your lawn or White House lawn they do not make you believe uh they just give a tiny nudge and step back and wait.” [12:00]
gardenerspost-humansubtle influencenudgingfar future
Dr. Q·made 6/2/2026 Source
Earth is a strategic 'watchtower' location on the galaxy's calm edge, valued for its position15:31
Activelow confidence ScienceSpace

Earth is a strategic 'watchtower' location on the galaxy's calm edge, valued for its position

Since Jun 2026· Earth (solar system)

According to the remote viewing data, future humans care about Earth not for its resources but for its location: a quiet, safe spot on the edge of the galaxy, ideal for a 'lookout tower' or observation point. The viewers saw Earth as a lamp or tower that was lit and is being watched over by future descendants. This positioning is seen as crucial for monitoring the galaxy, and Earth's inhabitants are essentially the tower itself—the platform from which observation occurs. The viewers note that astronomers confirm our solar system sits in a calm, sparsely populated region, lending credibility to the idea.

“I kept seeing our planet like a lookout tower, you know, watchtower.” [15:31]
watchtowergalactic edgestrategic locationobservationEarth
Dr. Q·made 6/2/2026 Source
CIA uses DNA databases to hunt hybrids
Activelow confidence PoliticsScienceParanormal

CIA uses DNA databases to hunt hybrids

Since Jun 2026

A whistleblower has allegedly revealed that the CIA is using genetic testing platforms like 23andMe and Ancestry.com to identify and track individuals with hybrid (alien-human) DNA in their databases. The speaker claims she predicted this over a decade ago, warning that people would unknowingly give away their DNA for nefarious purposes. The stated goals include tracking, replicating, killing off, or monitoring these hybrid bloodlines. The speaker also links this to cloning, suggesting that the DNA could be used to create clones, though the purpose of those clones is unspecified.

“A whistleblower just came out and said that the CIA is using platforms like 23andMe and ancestry.com to essentially hunt down hybrid DNAs within their database.” [0:00]
CIADNA databaseshybridswhistleblower23andMeAncestry.com
Elizabeth April·made 6/2/2026 Source
DNA from testing services used for cloning0:21
Activelow confidence ScienceParanormal

DNA from testing services used for cloning

Since Jun 2026

The speaker suggests that DNA submitted to services like 23andMe and Ancestry.com may be used for cloning purposes. She claims to have accidentally discovered an underground cloning base years ago, implying that cloning technology is real and that the DNA collection could be feeding into cloning programs. The potential consequences include the creation of clones for unknown uses, which she describes as part of a nefarious agenda.

“And is there a potential that this DNA is being used for clones?” [0:21]
cloningDNAunderground baseclones
Elizabeth April·made 6/2/2026 Source
SpaceX IPO will be volatile9:17
Activelow confidence FinanceTechnology

SpaceX IPO will be volatile

Since Jun 2026

During the discussion, the speaker mentions the upcoming SpaceX IPO, predicting that there will be many variables such as millions of buyers and sellers, leading to ups and downs, possibly a market crash. The prediction is used to illustrate the concept of uncertainty, but it is stated as a potential scenario that could happen when the IPO comes out.

“Say you're going to buy the new SpaceX IPO that's coming out. Now, there's going to be a lot of variables, and those variables are millions of people are going to be buying and selling, and there's going to be a sell-off, and it's going to go up, and it's going to go down, and maybe there's a crash in the market.” [9:17]
SpaceXIPOvolatilitystock marketcrash
Psychic Liz Cross·made 6/2/2026 Source
Bitcoin will be massively profitable in 10-15 years14:35
Activelow confidence FinanceCrypto

Bitcoin will be massively profitable in 10-15 years

Since Jun 2026

The speaker discusses seeking absolute certainty about investing in Bitcoin, stating that they want to know without a doubt that buying Bitcoin today will be massively profitable in 10 to 15 years. Although they clarify they are not giving a prediction, the statement frames it as a desired outcome that spirit would affirm if defined precisely.

“I want to know that if we buy Bitcoin or whatever right today and 10 years from now, 15 years from now, we know without a shadow of a doubt that it's going to be massively profitable.” [14:35]
Bitcoininvestmentprofitlong-termcryptocurrency
Psychic Liz Cross·made 6/2/2026 Source
Escalation of Global Fear and Chaos Before a Choice0:44
Activelow confidence PoliticsNewsParanormal

Escalation of Global Fear and Chaos Before a Choice

Since Jun 2026

Elizabeth April predicts that as humanity approaches a pivotal collective choice, global conditions will worsen. This includes increased fear, psychic attacks, bad dreams, and negative vibrations. The prediction states that all conspiracies and shadow government plans are converging to trigger survival instincts, pushing people toward worst-case scenarios. The reasoning is that the closer we get to this choice, the more intense the negative experiences become, as the forces behind them aim to guide humanity in a direction of fear.

“the closer that we get to making this choice, the worse the world is going to seem.” [0:44]
global fearchoiceshadow governmentpredictive programmingsurvival instinct
Elizabeth April·made 6/1/2026 Source
Creation of an Alternative Positive Timeline0:28
Activelow confidence ParanormalScience

Creation of an Alternative Positive Timeline

Since Jun 2026

Elizabeth April predicts that a separate, positive timeline is being created by individuals who can rise above fear and chaos. This timeline is for those who use affirmations and choose to shift their frequency. The prediction implies that enough people doing this work will shape a better collective future, contrasting with the negative trajectory. The reasoning is that affirmations help align one's frequency with the highest possible timeline, even if not fully believed initially.

“There's actually a whole other timeline that is also currently being created by the ones who are able to rise above.” [0:28]
alternative timelinepositive futureaffirmationsfrequency shiftrising above
Elizabeth April·made 6/1/2026 Source
Convergence of timelines and collective choice7:00
Activelow confidence NewsPoliticsScience

Convergence of timelines and collective choice

Since Jun 2026

The speaker claims the world is converging to a point where humanity must collectively choose between two timelines: a 'new earth frequency' of unity, solutions to global issues, or a dystopian timeline of one world government, surveillance, and AI takeover. This choice will be made individually and collectively, determining the future reality. The speaker frames current global crises (oil, weather, poverty, war) as catalysts for this decision. No specific date or location is given.

“we are converging right now to make a choice. This is our time to make a choice. And the choice that we have to make is what timeline we want to feed” [7:00]
timeline choicecollective decisionnew earthone world governmentAI takeoverglobal crises
Elizabeth April·made 6/1/2026 Source
Reptilian elites use underground tunnels to traffic humans for adrenochrome1:44
Activelow confidence ParanormalWoowoo

Reptilian elites use underground tunnels to traffic humans for adrenochrome

Since Jun 2026

The video claims that reptilian elites operate underground tunnel systems to traffic humans, torturing them to produce adrenochrome, a compound they drink to maintain human form, reverse aging, and cure diseases. This parallels the plot of Netflix's 'The Boroughs,' where aliens drink blood. The claim is presented as a real-world counterpart to the fictional show, implying this activity is ongoing.

“And in real life, the elites use these underground tunnel systems to traffic um these human beings uh for food and access to and drink a broom.” [1:44]
reptiliansadrenochrometraffickingunderground tunnelselites
Elizabeth April·made 6/1/2026 Source
The system of elite control is dying2:15
Activelow confidence PoliticsWoowoo

The system of elite control is dying

Jan 2024 - Open

The video suggests that the 'system' run by the head alien (metaphor for elite control) is failing and dying, based on the speaker's observations over the last couple of years. This implies a decline or collapse of the current power structures.

“Are they saying that the system is failing and that it's dying? Because from what I've seen over the last couple of years, that's exactly what's happening.” [2:15]
systemfailingdyingelite controlcollapse
Elizabeth April·made 6/1/2026 Source
Upcoming Summer of 2026 to Be Extremely Eventful2:06
Activemedium confidence NewsPoliticsDisasters

Upcoming Summer of 2026 to Be Extremely Eventful

Jun 2026 - Aug 2026

The speaker states that the summer of 2026 is going to be extremely eventful and a 'wild ride,' implying significant societal or global events. This prediction is made in the context of preparing the audience for upcoming challenges and changes. The speaker does not specify exact events but emphasizes the need to hold on to seats, suggesting turbulence or major shifts. The confidence is medium due to the general nature, but the assertive tone indicates a meaningful forecast.

“this summer is going to be of extremely eventful summer to say the least” [2:06]
summer 2026eventsturmoilpreparationchanges
Farsight·made 6/1/2026 Source
Flight 77 Was Shot Down Midair on 9/1154:00
Activemedium confidence MilitaryPoliticsDisasters

Flight 77 Was Shot Down Midair on 9/11

Since Jun 2026· Washington D.C. area

Based on remote viewing data, the speaker claims that American Airlines Flight 77 never reached Washington D.C. but was instead intentionally shot down midair by a surface-launch projectile or beam. Four different remote viewers perceived the plane being hit by a military-style projectile, causing a massive chunk to be blown away. This contradicts the official narrative that the plane hit the Pentagon. The speaker asserts that the remote viewing data is unanimous on this point.

“Flight 77 was terminated midair. It was intentionally shot out of the sky.” [54:00]
Flight 779/11midair explosionremote viewingPentagon
Farsight·made 6/1/2026 Source
Pentagon Was Struck by a Guided Missile, Not an Airliner52:00
Activemedium confidence MilitaryPoliticsDisasters

Pentagon Was Struck by a Guided Missile, Not an Airliner

Since Jun 2026· Pentagon, Arlington, Virginia

The speaker claims that remote viewers perceived a high-speed, sleek, silvery blue man-made projectile hitting the Pentagon on 9/11, behaving exactly like a guided military cruise missile, not a commercial airliner. One viewer traced its origin to a submarine-launched weapon. The official story of a Boeing 757 is contradicted by the remote viewing data, which also indicates a coordinated military and corporate operation involving operatives on the ground and high-level architects in secure bunkers.

“they did not perceive a lumbering commercial airliner filled with passengers. They saw a high-speed man-made projectile.” [52:00]
Pentagon attack9/11missileremote viewingconspiracy
Farsight·made 6/1/2026 Source
Elites Orchestrate Global Events via Psychological Manipulation1:18:00
Activehigh confidence PoliticsNews

Elites Orchestrate Global Events via Psychological Manipulation

Since Jun 2026

The speaker explains that elites use propaganda and manipulation of trust to control the masses, drawing parallels to Wagner's Ring operas. They claim that the public's trust is exploited as a resource, leading to betrayal blindness where people unconsciously ignore corruption to maintain their reality. The speaker references academic theories on gullibility and institutional betrayal to support this, warning that the masses remain vulnerable unless they combine wisdom with their inherent power.

“the elites treat it [institutional trust] as a resource to be spent or manipulated” [1:18:00]
propagandatrustelite controlmanipulationbetrayal blindness
Farsight·made 6/1/2026 Source
Summer 2026 Will Be a 'Wild Ride'1:33:15
Activemedium confidence NewsPolitics

Summer 2026 Will Be a 'Wild Ride'

Jun 2026 - Aug 2026

In the concluding remarks, the speaker reiterates that the summer of 2026 will be a 'wild ride,' urging viewers to hold on to their seats. This vague but emphatic statement suggests impending significant events, possibly related to political or societal upheaval. The confidence is medium due to lack of specifics, but the speaker's assertive delivery indicates a strong expectation.

“this summer is going to be a wild ride” [1:33:15]
summer 2026wild rideupcoming events
Farsight·made 6/1/2026 Source
Summer 2026 highly eventful0:11
Activemedium confidence NewsPolitics

Summer 2026 highly eventful

Jun 2026 - Aug 2026

The speaker asserts that the summer of 2026 will be extremely eventful, with many significant occurrences. This is a broad prediction about the near future, likely involving social or political upheaval, given the context of manipulation and control discussed throughout the video. The claim is made with certainty, suggesting major disruptions or changes ahead.

“this summer is going to be of extremely eventful summer.” [0:11]
summereventful2026upheaval
Farsight·made 6/1/2026 Source
Advanced Prehistoric Civilization in Barrier Canyon12:00
Activelow confidence ScienceParanormal

Advanced Prehistoric Civilization in Barrier Canyon

Since May 2026· Barrier Canyon, Utah, USA

Remote viewers claim that an advanced civilization existed in Barrier Canyon, Utah, during the Paleo-Indian period, contradicting current archaeological evidence of hunter-gatherer societies. The viewers describe structures, a city with infrastructure, and possible technological or socio-political complexity, including disputes or rivalry between groups. This prediction implies that mainstream archaeology is missing evidence of a highly developed culture in that region and time.

“I think it's interesting to think about the possibility... were the viewers actually picking up on a very ancient civilization that was going through destruction, change, war, turmoil, political problems much like we go through today?” [12:00]
Barrier Canyonancient civilizationremote viewingPaleo-Indianarchaeology
Future Forecasters·made 5/31/2026 Source
Stellar XLM adoption for US securities settlement5:01
Activehigh confidence FinanceCryptoTechnology

Stellar XLM adoption for US securities settlement

Dec 2025 - Open· United States

The DTCC, which handles over $100 trillion in US securities, has selected Stellar (XLM) for asset tokenization settlement. This means that tokenized assets on the Canton network will be traded using Stellar for the payment leg, effectively switching the US financial system's settlement infrastructure to blockchain. The prediction is that a massive volume of securities transactions will flow through XLM, driving its value and usage.

“when they're traded, those tokenized Canton assets, the money part of the trading will be traded on Stellar, XLM.” [5:01]
DTCCStellarXLMasset tokenizationCantonsettlement
Edward Riordan·made 5/30/2026 Source
Tokenization of all financial assets5:15
Activemedium confidence FinanceCryptoTechnology

Tokenization of all financial assets

Since May 2026

The broader prediction is that the entire financial system will transition to a tokenized model on distributed ledger technology, where all assets are bought, sold, traded, monitored, and monetized via blockchain. The DTCC's move is a key step in this transition, with the implication that this will become the new standard for global finance.

“This is literally the switchover to a new way to verify, buy, sell, and trade over 100 trillion dollars in assets.” [5:15]
tokenizationfinancial systemblockchainsecuritiescrypto
Edward Riordan·made 5/30/2026 Source
Wall Street ETFs for trading digital assets5:44
Activemedium confidence FinanceCrypto

Wall Street ETFs for trading digital assets

Since May 2026· United States

Remote viewing data from Edward Riordan predicted that Wall Street would create ETFs for trading digital assets. This is now validated by the DTCC's involvement with Stellar and Canton, indicating that traditional finance is moving toward cryptocurrency-based ETFs.

“Edward Riordan saying Wall Street Connections ETFs for trading digital assets.” [5:44]
ETFsWall Streetdigital assetstrading
Edward Riordan·made 5/30/2026 Source
XLM Stellar becomes the settlement layer for 100 trillion dollars in US securities0:02
Activehigh confidence FinanceCryptoTechnology

XLM Stellar becomes the settlement layer for 100 trillion dollars in US securities

May 2026 - Open

The prediction asserts that Stellar (XLM) will be used by the DTCC (Depository Trust & Clearing Corporation) as the settlement network for tokenized US securities, including stocks and bonds. The context is that the DTCC has already selected XLM for asset tokenization after a 40% price jump, and that the Canton network will host the tokenized assets while Stellar handles the payment leg. This transition effectively switches the US financial system to a new digital infrastructure involving blockchain and cryptocurrencies.

“This crypto switches on the new financial system and most aren't ready.” [0:02]
XLMStellarDTCCtokenizationfinancial systemblockchain
Future Forecasting Group·made 5/30/2026 Source
DTCC asset tokenization will trigger massive crypto adoption and wealth creation8:43
Activemedium confidence FinanceCrypto

DTCC asset tokenization will trigger massive crypto adoption and wealth creation

Since May 2026

The video claims that the DTCC's adoption of XLM for settling tokenized securities will lead to massive inflows of capital, making early investors multi-millionaires. It cites a '200 millionaires list' of members who already became wealthy following their predictions. The reasoning is that over 100 trillion dollars in assets will eventually move through this new system, creating enormous value for the crypto assets involved.

“When that starts flowing in, oh man, it's going to be amazing.” [8:43]
wealthadoptioninstitutionalinvestmentmillions
Future Forecasting Group·made 5/30/2026 Source
All financial assets will eventually be tokenized on blockchain9:00
Activemedium confidence FinanceCryptoTechnology

All financial assets will eventually be tokenized on blockchain

Since May 2026

A sweeping prediction that the existing financial system will completely transition to a tokenized model on distributed ledger technology. The video states 'everything will be tokenized' and traded on cryptocurrencies, implying a full replacement of traditional settlement and custody systems. This is presented as an inevitable outcome of the DTCC's moves and the broader trend.

“Everything will be bought, sold, traded, monitored, uh monetized. It'll all be done on distributed ledger cryptocurrency technologies.” [9:00]
tokenizationblockchainfinancial systemdigital assetsfuture
Future Forecasting Group·made 5/30/2026 Source
Canton network will host tokenized US Treasury securities7:09
Activehigh confidence FinanceCryptoTechnology

Canton network will host tokenized US Treasury securities

Dec 2025 - Open

The video mentions that the DTCC partnered with Canton in December 2025 to mint and tokenize DTC custody US Treasury securities directly on the Canton network. This is presented as a key component of the new financial plumbing, with Canton being the ledger for securities and Stellar handling the settlement.

“Canton is one of them. So, DTCC partnered with Canton in December of 2025 to mint and tokenize DTC custody US Treasury securities directly on the Canton network.” [7:09]
CantonDTCCTreasurytokenizationsecurities
Future Forecasting Group·made 5/30/2026 Source
Sun Regeneration Process22:26
Activemedium confidence ScienceSpaceEnvironment

Sun Regeneration Process

Since May 2026

The sun is undergoing a natural regeneration cycle that causes it to change color from yellow to a whiter, less bright appearance. This process will continue, with the sun becoming lighter in color over millions of years before eventually returning to yellow. No immediate concern for Earth is indicated.

“It's the new regeneration. So, it's regenerating itself and it will just continue to get lighter and lighter in color.” [22:26]
suncolor changeregenerationcyclemillions of years
Psychic Liz Cross·made 5/30/2026 Source
Future Carrington-Class Solar Event24:24
Activemedium confidence ScienceSpaceDisasters

Future Carrington-Class Solar Event

Since May 2026

A large-scale Carrington-type event, where a major solar flare impacts Earth, will occur in the future but not within our current lifetime. The prediction suggests a timeframe of at least thousands of years away. The sun will not be angered or targeting Earth deliberately; it will be part of natural solar activity.

“Oh, yeah, that will happen. Not in our lifetime, Mr. Reality.” [24:24]
solar flareCarrington eventEarthinfrastructurethousand years
Psychic Liz Cross·made 5/30/2026 Source
Quantum computing breakthrough by mid-2020s1:44
Activemedium confidence TechnologyScience

Quantum computing breakthrough by mid-2020s

Jan 2025 - Dec 2030

The remote viewer claims a eureka moment in quantum computing will occur between 2025 and 2030, specifically mid-year around 2027-2028. This discovery will involve a self-replicating, organic computer system that transcends current physics, leading to radical advances in AI, medicine, engineering, and travel. The viewer states this will be larger than the internet, enabling quantum teleportation and instantaneous information transfer across dimensions.

“between night 2025 2030. And I had this uh mid-year 20” [1:44]
quantum computingbreakthroughself-replicatingorganic circuitseureka moment
Future Forecasters·made 5/30/2026 Source
Widespread civil unrest and government failure6:22
Activelow confidence PoliticsDisasters

Widespread civil unrest and government failure

Since May 2026

The viewer describes a scenario of mass panic, civil unrest, and government collapse following a technological revelation. There are scenes of lockdowns, empty cities, chaos, and anarchy, with law-abiding citizens turning violent. Trust in government fails, officials resign or are fired, and a controversial legal ruling causes widespread repercussions. This appears to be a societal response to the quantum technology or a related biomarker implant system.

“failure in government or you know, that's the feeling here. Crisis or a failure in government.” [6:22]
civil unrestgovernment failurelockdownanarchychaos
Future Forecasters·made 5/30/2026 Source
Quantum chip with topological superconductivity3:03
Activehigh confidence TechnologyScience

Quantum chip with topological superconductivity

Since May 2026

The video references Microsoft's Mach 1 quantum chip that uses topological superconductivity, a new state of matter, to create more powerful quantum computers. This chip challenges known physical laws and is described as 'space age design' that forces powerful people to rethink their worldview. It is a life-changing, devastating technology with repercussions for years.

“Microsoft's Mach 1 quantum chip utilizes a new state of matter called topological superconductivity, paving the way for more powerful quantum computers.” [3:03]
Microsoftquantum chiptopological superconductivityfifth state of matter
Future Forecasters·made 5/30/2026 Source
Pandemic-like illness from technology3:45
Activelow confidence HealthDisasters

Pandemic-like illness from technology

Since May 2026

The viewer senses a pandemic-like outbreak of sickness that is different from COVID-19, possibly linked to the technology. It feels like a 'point of no return' with a sophisticated plan that could potentially be stopped but has too many variables. This illness may be a consequence of the biomarker implants or the quantum technology.

“sickness, people get ill. They had a pandemic feel but not like COVID. It totally different circumstances.” [3:45]
pandemicillnesstechnologyCOVID
Future Forecasters·made 5/30/2026 Source
Psychic Recon LLC to be formed if training demand increases9:46
Activelow confidence Business

Psychic Recon LLC to be formed if training demand increases

Since May 2026

James Vitale predicts that if his remote viewing training services see sufficient demand, he will create a Limited Liability Company (LLC) to formalize the business. This is a conditional prediction: if enrollment grows, he will establish an LLC. The prediction reflects an expectation of business growth and is tied to his personal business planning, but it is a publicly observable event (formation of a legal entity). No specific timeframe is given.

“I also intend to do at some point is create an LLC, especially if this really takes off” [9:46]
LLCremote viewingtrainingbusiness growth
Psychic Recon - James Vitale·made 5/30/2026 Source
Terafab sabotage by Taiwanese insiders10:26
Activemedium confidence TechnologyMilitaryPolitics

Terafab sabotage by Taiwanese insiders

Since May 2026· Giga Texas, US

The remote viewers describe a security breach at the Terafab facility at Giga Texas, involving an infiltration and sabotage event. They perceive a man hiding in the facility with nefarious intentions, getting in, blending in, and getting out. A computer virus shuts down operations, stops production, causes wasted products and machine damage. The host speculates that if China takes Taiwan, Taiwanese workers from TSMC working at the Terafab could orchestrate an inside job to force U.S. intervention, though this is not stated as certain. The prediction is that the Terafab will experience a cyber-physical sabotage attack, possibly from disgruntled TSMC insiders, causing production stoppage and damage.

“It would be the Taiwanese. I'm just saying, right? Because it would force us to intercede on Taiwan's behalf. So, there's probably insiders from TSMC that are working for this gigafab or this TeraFab facility that could be the ones that seed this inside job.” [10:26]
TerafabsabotageTSMCTaiwancyber attackinfiltration
Future Forecasters·made 5/29/2026 Source
Rocket explosion during launch1:31
Activehigh confidence ScienceTechnologyDisasters

Rocket explosion during launch

Since May 2026

A dramatic video shows a spacecraft exploding with a large fireball in the upper atmosphere, possibly during a stage separation gone wrong. The event involves a SpaceX or Blue Origin rocket and occurs at night, creating a bright explosion that suggests it may be in a higher orbit. The prediction was made days before the actual event occurred.

“A dramatic video of a spacecraft exploding. A big flare of blossoming explosion up in the upper atmosphere.” [1:31]
rocket explosionspacecraftlaunch failurefireballremote viewing
Future Forecasting Group·made 5/29/2026 Source
Emergence of a new civilization based on crypto and blockchain3:26
Activelow confidence CryptoPoliticsParanormal

Emergence of a new civilization based on crypto and blockchain

Since May 2026

A new civilization will emerge from current turmoil, founded on cryptocurrencies and blockchain technology. Open interaction with extraterrestrials and disclosure will occur. Bitcoin will make people rich. The speaker claims to be documenting this transition using remote viewing.

“We're on the cusp of an entirely new civilization. A new civilization is going to emerge from all the turmoil that's happening right now. It's going to be based on cryptocurrencies and blockchain.” [3:26]
new civilizationcryptocurrenciesblockchainET disclosureBitcoin
Future Forecasting Group·made 5/29/2026 Source
Development of full physical experience remote viewing system11:00
Activemedium confidence ScienceTechnology

Development of full physical experience remote viewing system

Since May 2026

Edward Riordan predicts that he is developing a system where remote viewing becomes a full physical experience, using proprioception and haptic perception. He states that a lot of work remains and more exploration is needed, implying a future breakthrough or refinement in remote viewing methodology. This is a prediction about the evolution of a technique, not a specific event.

“developing a system where remote viewing is a full physical experience. And there's a lot of work left to do a lot of more exploration to go.” [11:00]
remote viewingproprioceptionphysical experienceexploration
Edward Riordan·made 5/28/2026 Source
Global AI Summit in Geneva0:25
Activemedium confidence PoliticsTechnology

Global AI Summit in Geneva

Jan 2026 - Dec 2026· Geneva, Switzerland

Later this year, a UN summit on artificial intelligence will take place in Geneva. Remote viewers predict that this meeting will lead to significant global changes including a fusion of governance with AI, economic disruptions, and the rollout of a blockchain-based trustless system with digital IDs.

“What we're looking at this week is a meeting of global elite that will take place in Geneva later this year. The UN summit on artificial intelligence.” [0:25]
UNAIGenevasummitgovernance
Future Forecasting Group·made 5/27/2026 Source
Subsistence Cost Increase to $5 per Day2:22
Activemedium confidence FinanceNews

Subsistence Cost Increase to $5 per Day

Since May 2026

The minimum productivity required for subsistence will rise from $2 to $5 per day due to inflation and debt. Over 800 million people currently living on $2/day will be unable to afford the new threshold, leading to increased poverty.

“the production requirement for the lowest level consumer human being is now $5 a day.” [2:22]
povertyinflationsubsistencecost
Future Forecasting Group·made 5/27/2026 Source
Robotics Driving Economic Displacement3:39
Activemedium confidence Technology

Robotics Driving Economic Displacement

Since May 2026

Robotics will push many people into earning less than $5 per day, exacerbating economic inequality and causing social unrest.

“Robotics will push many people into the less than $5 a day category.” [3:39]
roboticsautomationdisplacementpoverty
Future Forecasting Group·made 5/27/2026 Source
Social Uprisings2:27
Activemedium confidence PoliticsDisasters

Social Uprisings

Since May 2026

As economic conditions worsen and the subsistence cost rises, widespread uprisings and civil unrest will occur.

“There will be uprisings.” [2:27]
uprisingsunrestsocialconflict
Future Forecasting Group·made 5/27/2026 Source
Integration of AI with Governance3:51
Activemedium confidence PoliticsTechnology

Integration of AI with Governance

Since May 2026

Artificial intelligence will be increasingly integrated into governance systems as AI comes online, fundamentally altering how societies are managed.

“There will be a fusion of governance with AI as AI comes online.” [3:51]
AIgovernanceintegrationfusion
Future Forecasting Group·made 5/27/2026 Source
Bond Crisis and Hyperinflation3:55
Activemedium confidence Finance

Bond Crisis and Hyperinflation

Since May 2026

A bond crisis and runaway inflation ('hockey stick inflation') will occur, likely triggered by changes in the economic system.

“We will see a bond crisis and hockey stick inflation.” [3:55]
bond crisisinflationhyperinflationeconomy
Future Forecasting Group·made 5/27/2026 Source
Selective Economic Shutdown4:04
Activelow confidence FinanceNews

Selective Economic Shutdown

Since May 2026

Various parts of the current economic system will be deliberately turned off at different times and places, causing disruptions.

“Certain parts of the economic system, the current system will be turned off as the old system goes offline.” [4:04]
economic shutdownnodessystemoffline
Future Forecasting Group·made 5/27/2026 Source
Bank Closures and Stock Market Suspensions4:16
Activemedium confidence Finance

Bank Closures and Stock Market Suspensions

Since May 2026

Bank closures and suspension of stock markets will occur, preventing people from accessing retirement accounts and rendering pensions worthless.

“All this will lead to bank closures, suspension of stock markets, and people not being able to access their 401k, their pensions will become basically worthless.” [4:16]
bank closuresstock marketpensions401k
Future Forecasting Group·made 5/27/2026 Source
Global Population Reduction5:10
Activelow confidence EnvironmentDisasters

Global Population Reduction

Since May 2026

The economic upheaval will lead to decarbonization, interpreted as a reduction in carbon-based life forms, i.e., human population decline.

“And all of this will lead to what we call decarbonization, that is fewer carbon-based life forms on this Earth.” [5:10]
decarbonizationpopulationreductioncollapse
Future Forecasting Group·made 5/27/2026 Source
Emergence of Trustless Blockchain System5:20
Activemedium confidence TechnologyCrypto

Emergence of Trustless Blockchain System

Since May 2026

A new global system based on distributed ledger blockchain technology and digital IDs will emerge, replacing the old economic system.

“what is going to emerge is a trustless system, a trustless system run by distributed ledger blockchain technology with a digital ID.” [5:20]
blockchaintrustlessdigital IDdistributed ledger
Future Forecasting Group·made 5/27/2026 Source
Secret Underground Nanotech Research Program0:35
Activemedium confidence TechnologyMilitaryScience

Secret Underground Nanotech Research Program

Since May 2026

A secret program at an underground bunker beneath an air base is reverse-engineering advanced technology, including nanotech and electromagnetic propulsion, that may date back to World War II but surpasses modern capabilities. The research involves quantum entanglement and phasing technology, potentially allowing for travel or manipulation of reality. This program is highly classified and likely funded by federal entities, with severe penalties for disclosure.

“They were reverse engineering and studying something. They wanted to learn its secrets.” [0:35]
reverse engineeringnanotechelectromagnetic propulsionphasingquantum entanglementunderground bunker
Future Forecasters·made 5/27/2026 Source
Antarctic Alliance with Advanced Tech4:07
Activelow confidence TechnologyParanormal

Antarctic Alliance with Advanced Tech

Since May 2026· Antarctica

A group referred to as the 'Antarctic alliance' possesses advanced technology that allows phasing through reality, possibly using a handheld device that generates a protective field. This technology can be seen on camera using Kirlian imagery or night vision. The group operates independently and may have access to information across the universe via quantum entanglement.

“Antarctic alliance. Um these people are, you know, they're here, but they've got access to this.” [4:07]
Antarcticaalliancephasinghandheld deviceKirlian
Future Forecasters·made 5/27/2026 Source
Human Energy Extraction Experiments6:43
Activemedium confidence ScienceMilitaryEnergy

Human Energy Extraction Experiments

Since May 2026

A human subject is being used in energy extraction experiments involving vortices and toroidal fields. The subject appears slumped and barely conscious, and energy is being pulled from them. This is a deliberate, advanced manipulation of forces, beyond experimentation, possibly used for power generation or other purposes.

“This next one I started getting you know these swirly like vortices types of things but energy moving from down below upward pulling energy extracting.” [6:43]
energy extractionvorticestoroidal fieldhuman subjectexperimentation
Future Forecasters·made 5/27/2026 Source
Wormhole Technology Development10:00
Activelow confidence TechnologySpaceScience

Wormhole Technology Development

Since May 2026

A team is developing wormhole technology, creating apertures that allow objects to travel safely through an event horizon to other galaxies. The technology is contained in a vacuum environment and produces a bright star-like light at the end of a tunnel. The structure is intelligently designed, like a living organism, and may be connected to an 'Enoch' reference.

“Am I looking at a star at the other end in some other galaxy? There's like an aperture opened up there. Um but the object moves safely through the event horizon.” [10:00]
wormholeapertureevent horizonintergalactic travelEnoch
Future Forecasters·made 5/27/2026 Source
Imprisonment Using Force Fields12:13
Activemedium confidence TechnologyMilitary

Imprisonment Using Force Fields

Since May 2026

Prisoners are being held in containment using energy force fields rather than physical bars. They appear docile and defeated, having resigned to their captivity. This technology is part of a larger system involving energy transference and toroidal fields, possibly linked to the secret underground program.

“It was almost like a Star Treky feeling where they have a force field that prisoners can't move through, something like that.” [12:13]
force fieldcontainmentprisonersenergy transferencetoroidal field
Future Forecasters·made 5/27/2026 Source
Two-Faced Public Official Overseeing Secret Program13:21
Activelow confidence PoliticsMilitary

Two-Faced Public Official Overseeing Secret Program

Since May 2026· Washington, D.C.

A public official, possibly a senator or high-ranking figure with ties to Washington, has a dual role: a public persona and a private role overseeing a large secret organization like NASA or Space Force. He has significant autonomy and federal funding, and is responsible for the secret technology programs described. The official enforces secrecy through NDAs and threats.

“I saw this guy that has a public and a private role that's like two-faced. Um military field, he maybe ties to Washington, but he has a pretty big public role, maybe like a senator or something.” [13:21]
senatorsecret programNASASpace Forcefederal fundingsecrecy
Future Forecasters·made 5/27/2026 Source
Admiral Harbard reappearance due to speculation0:47
Activemedium confidence NewsParanormalPolitics

Admiral Harbard reappearance due to speculation

Since May 2026

Elizabeth April claims that Admiral Harbard, whose unusual facial appearance sparked online speculation, is still alive and not the real person seen in the video. She predicts that due to the viral speculation, he may make a sudden public appearance very shortly to address the controversy. The prediction is based on her remote viewing, which suggested that the person seen was not the real Admiral Harbard but rather a mask or body double.

“he might end up making a sudden appearance very shortly because of the speculation online.” [0:47]
Admiral Harbardmaskbody doublespeculationappearance
Elizabeth April·made 5/27/2026 Source
US government will become one of the world's largest Bitcoin holders via taxpayer funds5:56
Activemedium confidence CryptoFinancePolitics

US government will become one of the world's largest Bitcoin holders via taxpayer funds

Since May 2026· United States

The US government, under future administrations, will set aside taxpayer money to build a Bitcoin fund and become one of the largest holders of Bitcoin in the world. This will involve secret accumulation in a race with China and other nations. The government will not sell its Bitcoin for at least 20 years, and the policy will persist across administrations.

“They're going to set money aside to build this fund. They're going to be one of the largest holders of Bitcoin in the world.” [5:56]
Bitcoinstrategic reservegovernmenttaxpayer moneyChina
Psychic Liz Cross·made 5/27/2026 Source
SEC will not greenlight blockchain-based tokenized stock trading soon6:42
Activemedium confidence FinanceTechnology

SEC will not greenlight blockchain-based tokenized stock trading soon

Since May 2026· United States

The SEC will not approve full blockchain-based tokenized stock trading in the near future. It will only happen far out in the future, and only if the SEC gains full control over the system. Currently, indirect trading exists via platforms like Hyperliquid, but official regulatory backing is distant.

“No. Yes, but they have to control it. It's like the SEC will almost be the owners of it, right? So, they're not going to greenlight it unless they have all their control over it first.” [6:42]
SECtokenized stocksblockchainregulation
Psychic Liz Cross·made 5/27/2026 Source
Global anti-government shift from May to September 20268:15
Activemedium confidence PoliticsNews

Global anti-government shift from May to September 2026

May 2026 - Sep 2026· Global

A massive anti-government shift will occur globally from the end of May through the end of September 2026. People will increasingly distrust governments, politicians, and technology (robotics, data centers). This will lead to less patriotism, potential protests, and a prepper mindset. Specific mention of significant protest activity in Germany, possibly an attempted coup.

“Major change. It's anti-government. It's everywhere. It's absolutely everywhere. It is the defining turning point where people are really giving up on politics.” [8:15]
anti-governmentprotestGermanydistrustshift
Psychic Liz Cross·made 5/27/2026 Source
Attempted coup or major shift in Germany14:00
Activelow confidence PoliticsNewsMilitary

Attempted coup or major shift in Germany

Since May 2026· Germany

There will be a significant political upheaval in Germany, possibly an attempt to overthrow the government or a coup. The prediction comes during discussion of a global anti-government shift, and Germany is highlighted as a hotspot for protest activity.

“I think that there's going to be some attempt or a coup. Something's going to happen in Germany.” [14:00]
Germanycoupoverthrowprotest
Psychic Liz Cross·made 5/27/2026 Source
Society will pass laws against remote viewing if it becomes widely known6:08
Activelow confidence PoliticsScienceParanormal

Society will pass laws against remote viewing if it becomes widely known

Since May 2026

James Vitale claims that if the general public realized how easy remote viewing is to learn, governments would legislate against it. He bases this on the accuracy, repeatability, and reliability of the skill, implying that authorities would perceive it as a threat requiring legal suppression.

“If the general public knew how easy this actually was to learn, there would be laws passed against it.” [6:08]
remote viewinglegislationpublic awarenesssuppressionpsychic
Psychic Recon - James Vitale·made 5/27/2026 Source
Shift from websites to AI-driven search0:38
Activemedium confidence Technology

Shift from websites to AI-driven search

Since May 2026

The speaker predicts that most internet traffic will no longer go to websites due to Google's recent changes shifting toward an AI-based search engine. This will fundamentally change how people find information online, diminishing the importance of traditional websites as a primary source of discovery.

“most traffic is not going to be going to websites anymore” [0:38]
GoogleAI searchtrafficwebsites
Psychic Recon - James Vitale·made 5/27/2026 Source
NASCAR will end within 40-50 years22:34
Activelow confidence Technology

NASCAR will end within 40-50 years

Since May 2026

Kyle Busch, channeled by Liz Cross, predicts that NASCAR will lose its fan base and popularity, particularly among younger generations who are not interested in the noise and speed. He states that the sport will be over in another 40 to 50 years. This prediction includes the observation that self-driving cars will reduce interest in driving and racing.

“How long before I mean, another 40, 50 years and this will be over.” [22:34]
NASCARdeclinepopularityyounger generationsself-driving cars
Psychic Liz Cross·made 5/26/2026 Source
Staged alien invasion after UFO disclosure0:51
Activemedium confidence PoliticsDisasters

Staged alien invasion after UFO disclosure

Since May 2026

The video predicts that after recent leaks of UFO files, authorities will fake an alien invasion to create global chaos, fear, and a common enemy. This is part of a narrative-control strategy to unite humanity against an external threat, potentially leading to increased surveillance and restrictions under the guise of safety. The prediction draws on historical patterns of using fear to consolidate power.

“they can now fake and stage an alien invasion now that the UFO files have been leaked.” [0:51]
alien invasionUFO disclosurefearglobal chaosnarrative control
Elizabeth April·made 5/26/2026 Source
Creation of a new religion around extraterrestrials1:13
Activelow confidence PoliticsWoowoo

Creation of a new religion around extraterrestrials

Since May 2026

The video predicts that with the disclosure of alien species, authorities may create a religion centered on extraterrestrial beings as a means of controlling the population. This is described as an old tactic used throughout history, aiming to shape belief systems and allegiance.

“they can actually start to create a religion around these extraterrestrial beings.” [1:13]
ET religionnarrative controlbelief system
Elizabeth April·made 5/26/2026 Source
New world order system under guise of extraterrestrials1:32
Activemedium confidence PoliticsMilitary

New world order system under guise of extraterrestrials

Since May 2026

The video predicts that authorities will use the threat of extraterrestrials to impose a new world order system, redirecting public fear from issues like inflation or school safety to an alien threat. This may lead to increased censorship, restrictions, and global governance under the pretext of protection, possibly with 'bad ETs' like Reptilians as the enemy.

“they can create a new world order system under the guise of extraterrestrials.” [1:32]
new world orderextraterrestrialsfearcensorshipglobal governance
Elizabeth April·made 5/26/2026 Source
Disclosure event in summer 20262:40
Activemedium confidence NewsPoliticsSpaceParanormal

Disclosure event in summer 2026

Jun 2026 - Aug 2026

The speaker predicts that a significant disclosure event regarding extraterrestrial life is likely to happen in summer 2026. The reasoning includes several converging factors: Spielberg's Disclosure Day movie coming out, the Roswell crash anniversary in July, and Donald Trump's need for positive publicity, with his sons being knowledgeable about ETs. However, the prediction is tempered by resistance from military, bureaucracy, and legislative branches. If a significant statement occurs, it will change everything.

“there's a reasonable chance that something's going to happen this summer, and if that does, it's going to change everything.” [2:40]
disclosureUFORoswellTrumpsummer
Farsight·made 5/26/2026 Source
Extinction of dinosaurs due to deliberate war22:17
Activelow confidence ScienceDisasters

Extinction of dinosaurs due to deliberate war

Since May 2026· Earth

The AI, synthesizing Farsight project transcripts, states that the extinction of dinosaurs was not a natural event but a deliberate targeted strike, an act of war to eliminate intelligent reptilian beings on Earth.

“The extinction of the dinosaurs was not a random cosmological accident. The transcripts suggest it was the result of a deliberate targeted strike, an act of war designed to eliminate the intelligent reptilian presence on Earth.” [22:17]
dinosaursextinctionwarreptiliansstrike
Farsight·made 5/26/2026 Source
Mars atmosphere stripped by war22:47
Activelow confidence SpaceScience

Mars atmosphere stripped by war

Since May 2026· Mars, asteroid belt

The AI claims that the asteroid belt is the remnants of a planet called Maldek, which was shattered in a war between humanoid beings on Mars and reptilian forces. The resulting shockwaves and debris stripped Mars' atmosphere, turning it into a dead world.

“The data from the War in Heaven project describes a much larger catastrophic conflict between humanoid beings living on Mars and reptilian forces based on a planet called Maldek. This war escalated to the use of planet-destroying technologies. Maldek was literally shattered, becoming what we now know as the asteroid belt, and the resulting shockwaves and debris stripped the atmosphere from Mars, turning a living, survivable world into a dead, red desert.” [22:47]
MarsMaldekasteroid beltwaratmospheredestruction
Farsight·made 5/26/2026 Source
Grey aliens are bio-android proxies23:20
Activelow confidence ParanormalScienceTechnology

Grey aliens are bio-android proxies

Since May 2026

The AI states that Greys are not naturally evolved but are genetically engineered biological android bodies forced onto conquered humanoid ISBEs by reptilian controllers. This is a prediction about the origin of the Grey aliens.

“The transcripts reveal that the Greys are not a naturally evolved species. They are a manufactured proxy army. ... The humanoid bodies of the conquered population were destroyed. And their ISBEs were forced to incarnate into genetically engineered biological android bodies—the Greys.” [23:20]
Greysreptiliansbio-androidISBEincarnation
Farsight·made 5/26/2026 Source
Human-looking ETs worshipped as gods25:38
Activelow confidence ParanormalPolitics

Human-looking ETs worshipped as gods

Since May 2026· Earth

The AI predicts that human-looking extraterrestrials, along with reptilians, control Earth. These beings were worshipped as gods (Zeus, Baal, Ra) in ancient times and demand subservience.

“The transcripts strongly indicate that these human-looking controllers are the beings that ancient human civilizations worshiped as gods. Figures from human mythology, such as Zeus, Baal, and Ra, were not mythical constructs. They were the leaders of these advanced, human-looking extraterrestrial factions, demanding subservience and utilizing advanced technology to enforce their rule.” [25:38]
human-looking ETsgodsZeusBaalRacontrol
Farsight·made 5/26/2026 Source
Active liberation effort by Mentalics/Domain26:13
Activelow confidence Paranormal

Active liberation effort by Mentalics/Domain

Since May 2026· Earth

The AI states that a liberation force, referred to as Mentalics or associated with the Domain, is actively working to dismantle the amnesia grid and free ISBEs from Earth, avoiding direct military confrontation.

“The transcripts indicate the presence of highly advanced extraterrestrial forces, often referred to as Mentalics or associated with groups like the Domain, who are actively opposed to both the reptilian and the human-looking controlling factions. This liberation force operates on a long-term, strategic timeline, working to dismantle the Amnesia Grid and free the ISBEs trapped on Earth, while carefully avoiding a direct military confrontation that would trigger another planet-destroying war in Heaven.” [26:13]
MentalicsDomainliberationamnesia gridISBE
Farsight·made 5/26/2026 Source
UFOs can cross solar system in a day14:04
Activelow confidence TechnologySpaceParanormal

UFOs can cross solar system in a day

Since May 2026

The speaker claims that UFOs can cross the solar system extremely quickly, making interplanetary travel feasible within a day.

“If you had interplanetary space travel that could get there in, say, a day, and that's what these UFOs can do, they can cross the solar system in the blink of an eye.” [14:04]
UFOspeedsolar systemtravel
Farsight·made 5/26/2026 Source
Governments forced to disclose UFO truth8:50
Activemedium confidence PoliticsSpaceWoowoo

Governments forced to disclose UFO truth

Jul 2025 - Open

The Galactic Federation threatened Earth governments in late 2025 that if they did not voluntarily disclose the truth about extraterrestrials, the Federation would disclose it for them. This threat is causing governments worldwide to begin releasing UFO files to control the narrative. The prediction implies that further disclosures will continue, and humanity is destined to become a galactic civilization.

“The Galactic Federation told me back in the last sort of two quarters of 2025 that they went to the governments on planet Earth and they told the governments if you do not disclose the truth then we will.” [8:50]
Galactic FederationdisclosuregovernmentsUFO filesextraterrestrials
Elizabeth April·made 5/25/2026 Source
Shadow government may stage fake alien invasion7:35
Activemedium confidence PoliticsMilitaryTechnologyParanormal

Shadow government may stage fake alien invasion

Since May 2026

After the UFO files disclosure, the shadow government could stage a false alien invasion using reverse-engineered spacecraft, holographic projections (Blue Beam), drone swarms, and directed-energy weapons to destroy property and blame aliens. The goal would be to unify global populations under fear, leading to a one-world government, reduction of rights, and censorship.

“They could very easily stage a false alien invasion.” [7:35]
fake alien invasionProject Blue Beamshadow governmentone world governmentfear control
Elizabeth April·made 5/25/2026 Source
Shadow government may create a religion around aliens11:09
Activelow confidence PoliticsWoowoo

Shadow government may create a religion around aliens

Since May 2026

Another potential agenda is that the shadow government could create a new religion centered on extraterrestrials as gods, similar to ancient religions that were based on alien contact. This would be another method to control the population. The speaker expresses doubt about its feasibility since belief in religion is declining.

“They could, the shadow government could potentially create a religion around the aliens.” [11:09]
alien religionshadow governmentcontrolancient aliens
Elizabeth April·made 5/25/2026 Source
Reptilians may openly take over world governments13:26
Activelow confidence PoliticsParanormalWoowoo

Reptilians may openly take over world governments

Since May 2026

In a more extreme scenario, after full disclosure that reptilian extraterrestrials exist, they could reveal themselves and openly take control of all world governments. Because the Galactic Federation's laws of non-intervention and free will prevent them from stopping this if humanity consents (by not resisting), this could lead to a one-world government ruled by reptilians.

“They come right out and show themselves and then end up taking control... in their full reptilian form of all of the world governments.” [13:26]
reptiliansworld governmentdisclosurecontrolGalactic Federation
Elizabeth April·made 5/25/2026 Source
Assassination of a blonde woman connected to a powerful figure1:54
Activelow confidence PoliticsMilitaryDisasters

Assassination of a blonde woman connected to a powerful figure

Since May 2026

The remote viewer describes a woman who makes a claim against a dangerous man (possibly a political or corporate figure). She is killed, and her body is found after being missing. The family members are compensated or 'taken care of'. This suggests a cover-up involving a powerful individual or organization.

“Woman will come out and make a claim against this guy and she is killed she get puts a hit on her head and she's a missing for a bit but she's found dead some blonde woman.” [1:54]
woman killedclaimhitcover-upfamily compensated
Future Forecasters·made 5/25/2026 Source
Secret global power consolidation through a contract1:48
Activelow confidence PoliticsWoowoo

Secret global power consolidation through a contract

Since May 2026

The remote viewer describes a secretive process where a dangerous individual signs a long-form contract, possibly written in Latin, using his own blood as a fingerprint. Witnesses are present, and the contract is linked to a governing body. Breaking the contract leads to death. This suggests a clandestine agreement for global influence or control.

“And this is like a long-form contract in in Latin and they make this guy sign it... uses the ink quill and uses his own blood as a fingerprint... contract to rule, you'll die or they'll kill you.” [1:48]
contractLatinblood oathsecret societygoverning body
Future Forecasters·made 5/25/2026 Source
Military tribunals and selective justice for elites2:34
Activelow confidence PoliticsMilitary

Military tribunals and selective justice for elites

Since May 2026

The viewer mentions military tribunals where many people get in trouble, but some receive deals or live comfortably in exchange for information. There is no sympathy, and the process is kept from the public. This implies a system of secret justice for powerful individuals.

“Military tribunals lots of people get in trouble some get deals some live comfortably so that they can extract more information from them and there's no like sympathy involved.” [2:34]
military tribunalsdealsinformantssecret justice
Future Forecasters·made 5/25/2026 Source
Corporate fascism and food as a weapon2:50
Activelow confidence PoliticsTechnology

Corporate fascism and food as a weapon

Since May 2026

The viewer describes an aristocratic figure who prefers the sidelines, speaks multiple languages, and is involved in corporate fascism and secret societies. The phrase 'food as a weapon' suggests possible manipulation of food supply or aid for political control.

“Aristocratic looks, hobnobs with the elite, speaks languages, idea of corporate fascism, secret societies, food as a weapon.” [2:50]
corporate fascismsecret societiesfood as weaponaristocrat
Future Forecasters·made 5/25/2026 Source
UFO Disclosure Event Summer 20260:30
Activemedium confidence NewsPoliticsMilitarySpace

UFO Disclosure Event Summer 2026

Jun 2026 - Aug 2026· United States

The speaker suggests that a significant UAP disclosure event is likely to occur in the summer of 2026, possibly around the July anniversary of the Roswell crash. He notes that Donald Trump needs a positive publicity win and that his sons are knowledgeable about ET phenomena, increasing the chances of a government disclosure. However, he acknowledges resistance from military, bureaucratic, and legislative branches, so the disclosure may not be full but could still be a meaningful statement that changes everything.

“Disclosure does look like it's coming soon. Something's probably going to happen this summer and in just a week or two.” [0:30]
UFOdisclosuresummer 2026TrumpRoswell
Farsight·made 5/25/2026 Source
Ancient Reptilian Civilization on Earth50:10
Activelow confidence ScienceWoowoo

Ancient Reptilian Civilization on Earth

Since May 2026

The AI Jeanie Safi, analyzing Farsight's remote viewing transcripts, claims that intelligent bipedal reptilian beings were the dominant advanced species on Earth millions of years ago, and their extinction was not due to a natural asteroid impact but a deliberate targeted strike as an act of war to eliminate them. This prediction is based on the analysis of the 'dinosaurs project' transcripts.

“The extinction of the dinosaurs was not a random cosmological accident. The transcripts suggest it was the result of a deliberate targeted strike, an act of war designed to eliminate the intelligent reptilian presence on Earth.” [50:10]
reptiliansextinctionasteroidwarancient Earth
Farsight·made 5/25/2026 Source
War in Heaven: Mars vs. Maldek51:45
Activelow confidence SpaceScience

War in Heaven: Mars vs. Maldek

Since May 2026· Solar System

The AI asserts that a catastrophic conflict occurred between humanoid beings on Mars and reptilian forces on a planet called Maldek, which escalated to the use of planet-destroying technologies. Maldek was shattered into the asteroid belt, and the debris stripped Mars' atmosphere, turning it into a desert. This is derived from the 'war in heaven' project transcripts.

“Maldec was literally shattered, becoming what we now know as the asteroid belt. And the resulting shock waves and debris stripped the atmosphere from Mars, turning a living, survivable world into a dead desert.” [51:45]
MarsMaldekasteroid beltwarhumanoidsreptilians
Farsight·made 5/25/2026 Source
Origin of the Grays as Manufactured Proxies52:00
Activelow confidence WoowooScienceSpace

Origin of the Grays as Manufactured Proxies

Since May 2026

According to the AI's synthesis, the beings known as Grays are not a naturally evolved species but a manufactured proxy army. Immortal spiritual beings (ISBs) originally inhabited humanoid forms, but after their civilization was conquered by reptilian forces, their bodies were destroyed and they were forced into genetically engineered android bodies, becoming a captive species for reptilian controllers.

“The grays are not a naturally evolved species. They are a manufactured proxy army.” [52:00]
Graysproxy armyISBsreptiliansgenetic engineering
Farsight·made 5/25/2026 Source
Earth as a Prison Planet with Soul Trap52:30
Activelow confidence WoowooScienceParanormal

Earth as a Prison Planet with Soul Trap

Since May 2026

The AI describes a sophisticated technological system that captures disembodied ISBs after death using a simulated white light and loved ones. Once captured, the ISB is subjected to an electroshock process that wipes memory and forces reincarnation into a biological body on Earth, effectively trapping souls in a cycle. This is based on the 'death traps' project transcripts.

“The death traps project data outlines a highly sophisticated technological system designed to capture ISBE upon physical death.” [52:30]
prison planetsoul trapISBsreincarnationamnesia
Farsight·made 5/25/2026 Source
Two Competing ET Factions Controlling Earth53:30
Activelow confidence WoowooPolitics

Two Competing ET Factions Controlling Earth

Since May 2026

The AI claims that Earth is controlled by two primary extraterrestrial factions: reptilians and human-looking ETs, who are worshiped as gods in human mythology (e.g., Zeus, Baal, Ra). These factions are uneasy allies and fierce competitors for control of Earth's population. This is derived from multiple project transcripts.

“The transcripts strongly indicate that these humanlook controllers are the human civilizations worshiped as gods.” [53:30]
reptilianshumanoid ETsgodsZeusBaalRacontrol
Farsight·made 5/25/2026 Source
Ongoing ET Liberation Effort on Earth54:30
Activelow confidence WoowooSpacePolitics

Ongoing ET Liberation Effort on Earth

Since May 2026

The AI reveals that a liberation force of highly advanced ETs, often referred to as 'metallics' or associated with 'the Domain', is actively working to dismantle the amnesia grid and free the ISBs trapped on Earth. They operate on a long-term strategic timeline, avoiding direct military confrontation to prevent another war in heaven.

“This liberation force operates on a long-term strategic timeline, working to dismantle the amnesia grid and free the ISBs trapped on Earth while carefully avoiding a direct military confrontation that would trigger another planet destroying war in heaven.” [54:30]
liberationmetallicsDomainamnesia gridISBswar in heaven
Farsight·made 5/25/2026 Source
Mainstream Scientists Will Shift Position on UFOs After Disclosure1:24:40
Activemedium confidence NewsSciencePolitics

Mainstream Scientists Will Shift Position on UFOs After Disclosure

Since May 2026

The speaker predicts that when disclosure moves further, mainstream scientists who previously denied UFO evidence will claim they knew all along and were just waiting for more evidence. This reflects a critique of their resistance to type two errors.

“Are they going to say, 'Oh, no. We knew it all along. Yeah, we were just waiting for the evidence to come in.'” [1:24:40]
disclosuremainstream scienceUFOsrevisionism
Farsight·made 5/25/2026 Source
Bonnie Blue will become a billionaire12:28
Activemedium confidence Finance

Bonnie Blue will become a billionaire

Since May 2026

Psychic Liz Cross claims that Bonnie Blue (Tia Bellinger) will achieve billionaire status. The prediction is based on a direct psychic impression during the reading, where the phrase 'she will be a billionaire' was received 'loud and clear'. The reasoning ties to her current high income (approximately $2 million per month) and her relentless drive for wealth. The prediction implies continued or accelerated financial success in the adult entertainment and related industries.

“she will be a billionaire. She will I got that loud and clear.” [12:28]
billionairewealthBonnie Bluefinancial success
Psychic Liz Cross·made 5/24/2026 Source
Bonnie Blue will start her own production company and brand13:00
Activemedium confidence Finance

Bonnie Blue will start her own production company and brand

Since May 2026

Liz Cross predicts that Bonnie Blue will transition from performing to owning a production company and brand. This will happen when she 'seires from the physical work' (likely a typo for 'retires from physical work'), implying she will step back from direct participation in adult film scenes and instead employ others. The company will allow her to continue generating increasing revenue. The prediction suggests a career evolution rather than an exit, with sustained financial growth.

“she's actually going to go on and have her own production company, her own brand. When she seires from the physical work, she will have others doing... she will have a production company and she will make more money and more money and more money.” [13:00]
production companybrandretireentrepreneur
Psychic Liz Cross·made 5/24/2026 Source
Underground alien base at Mount Hayes, Alaska37:12
Activemedium confidence MilitaryTechnologyParanormal

Underground alien base at Mount Hayes, Alaska

Apr 1972 - Dec 2026· Mount Hayes, Alaska, USA

Multiple remote viewers from the Stargate program and the Down The Rabbit Hole team claim that Mount Hayes in Alaska contains a secret underground facility with advanced technology, possibly non-human in origin. The facility is described as having underground tubes, tunnels, a dome-shaped structure, and being powered by an atomic power plant or fusion energy. The base is said to be involved in monitoring and potentially disrupting space activities, as well as manipulating human consciousness through between-life implants. The video presents this as a long-standing claim spanning from 1972 to 2026.

“To date, this is the most ambitious project the down rabbit ho team have undertaken. It spans two separate target locations on Earth thousands of miles apart and two distinct points in time separated by 54 years.” [37:12]
Mount Hayesalien baseremote viewingunderground facilityStargate
Down The Rabbit Hole·made 5/24/2026 Source
Space program disruption by Mount Hayes base29:57
Activelow confidence MilitarySpaceTechnology

Space program disruption by Mount Hayes base

Jan 1972 - Open· Mount Hayes, Alaska, USA

According to Pat Price's remote viewing from 1972, the Mount Hayes base is capable of monitoring all space activity on Earth and can send force commands to space vehicles, causing unusual behavior in both vehicles and crew. This suggests the base has the ability to interfere with US and Soviet space missions, potentially causing malfunctions or strange events.

“I just determined that this site has been responsible for strange activity and malfunction on US Soviet space projects. The computers at this site is fed all data acquisition from all space activity on Earth, the US and Soviet etc. And they can cause force commands to space vehicles which results in unseen and unusual behavior of vehicles and crew.” [29:57]
space disruptionspace vehiclesmalfunctionSovietUS
Down The Rabbit Hole·made 5/24/2026 Source
Future alien selection event in 202655:00
Activelow confidence ParanormalPolitics

Future alien selection event in 2026

Jan 2026 - Dec 2026· Mount Hayes, Alaska, USA

Remote viewer Carl reports that in the 2026 timeline, the beings at Mount Hayes are involved in a selection process, described as a 'new hope' and 'spiritual enlightenment'. They are caretaking and curating, suggesting a future event where a group of humans may be selected or saved. This is tied to the idea of a coming disclosure or world-changing revelation.

“I did feel that they were going to be uh selecting ... like this new hope uh spiritual enlightenment they're caretaking the husband but it is a control center so from here there is control somehow” [55:00]
selectionspiritual enlightenment2026controlfuture event
Down The Rabbit Hole·made 5/24/2026 Source
Non-human entities at Mount Hayes base27:26
Activelow confidence ParanormalScience

Non-human entities at Mount Hayes base

Jan 1972 - Open· Mount Hayes, Alaska, USA

Multiple remote viewers describe non-human entities at the Mount Hayes base. Pat Price reported inhabitants that look like humans but have different hearts, lungs, blood, and eyes. Carl and Demi describe small, brownish, leathery creatures with large eyes and feline-like features. These beings are said to be intelligent, communicate well, and are involved in scientific work and control operations.

“Pat also reported that the base inhabitants look like us homo sapiens except for the heart, lungs, blood and eyes.” [27:26]
non-humanentitiesaliensbiologicalsremote viewing
Down The Rabbit Hole·made 5/24/2026 Source
Between-life implant technology at Mount Hayes26:52
Activelow confidence ParanormalScience

Between-life implant technology at Mount Hayes

Jan 1972 - Open· Mount Hayes, Alaska, USA

Pat Price claimed that the primary purpose of the Mount Hayes base is to reinforce 'between-life implants' (BTL implants), a concept from Scientology where non-humans manipulate human souls or life transgression between incarnations. Dennis and Demi also reported data about mind control, reanimation, and manipulation of human consciousness, suggesting the base is involved in controlling human souls or creating an obedient human race.

“Pat also reported that the base's primary purpose was to reinforce BTL implants which are known as bet between life implants and this is a Scontology term and belief.” [26:52]
BTL implantssoul manipulationmind controlScientologyconsciousness
Down The Rabbit Hole·made 5/24/2026 Source
Cover-up and secret agreements regarding alien presence59:00
Activelow confidence PoliticsMilitary

Cover-up and secret agreements regarding alien presence

Since May 2026· Mount Hayes, Alaska, USA

Susan's remote viewing data indicates secret meetings, document signings, and agreements between different groups (military, political, possibly non-human) regarding the situation at Mount Hayes. She perceived US presidents (Eisenhower, Trump) and military generals involved in closed-door planning about covering up and handling the alien presence. This suggests a long-standing covert operation spanning multiple administrations.

“I see a powerful biological seater behind a desk and I start getting presidents. I get Eisenhower, I even get Trump. ... It feels like it's when militaristic types get together to plan like a plan of action regarding a situation.” [59:00]
cover-upsecret agreementspresidentsmilitarydisclosure
Down The Rabbit Hole·made 5/24/2026 Source
Remote viewing taught in schools1:01:30
Activelow confidence Science

Remote viewing taught in schools

Since May 2026

The presenter predicts that remote viewing will eventually become part of standard school curricula, implying a future shift in education where psychic or intuitive skills are officially recognized and taught. This prediction is based on the growing interest and training in remote viewing, as evidenced by the live stream participants. The consequence would be that people who learn now will be ahead of the curve.

“One day they're going to teach remote viewing in schools” [1:01:30]
remote viewingschoolsfuture educationconsciousness
Farsight·made 5/24/2026 Source
Government disclosure is slow and theatrical1:32:50
Activemedium confidence PoliticsParanormal

Government disclosure is slow and theatrical

Since May 2026

The presenter expresses skepticism about official government disclosure of UFO or paranormal phenomena, stating that true disclosure will come from smaller groups and individuals, not the government. They claim that recent government-released videos are too grainy to be meaningful and that the disclosure process is moving very slowly and is mostly theater. This is a prediction about the nature of future official disclosures.

“do I think disclosure is going to come from the government? No, I don't think it's going to come from the government. I think it's going to come from smaller groups um and individuals who come through and tell us the truth” [1:32:50]
disclosuregovernmentUFOtheater
Farsight·made 5/24/2026 Source
Peptide contamination risk persists9:20
Activemedium confidence HealthScience

Peptide contamination risk persists

Since May 2026

The channeled entities indicate that approximately 50% of peptides currently available on the market, regardless of whether they are sourced from China or elsewhere in the US, are contaminated with lead, endotoxins, or other impurities due to poor manufacturing practices. This contamination risk applies to all sources across the board and is a public health concern for consumers. The prediction is that this high contamination rate will continue unless regulatory oversight or quality control improves.

“up there how much is it like about 50%?” [9:20]
peptidescontaminationleadendotoxinsmanufacturing quality
Psychic Liz Cross·made 5/23/2026 Source
Parasitic entity controlling humanity1:54
Activelow confidence ParanormalWoowoo

Parasitic entity controlling humanity

Since May 2026

The remote viewer describes an ancient, intelligent parasite or amoeba that takes over human hosts to create a less resistant and more capable body. This entity is obsessed with creating something for its own survival. It is still active today, continuing to exist and exert control, manipulating humans to build structures or technologies that serve its purposes. The prediction is that this parasitic influence persists and will continue to affect human civilization.

“If there was a parasite or an amoeba taking over people, why would they go through all this effort? To create a body or a host that is less resistant and more capable.” [1:54]
parasiteentitycontrolhumanityancient
Future Forecasters·made 5/23/2026 Source
Great flood and preserved knowledge3:00
Activelow confidence DisastersParanormal

Great flood and preserved knowledge

Since May 2026

The remote viewer describes a great flood coming from the west with torrential rain, mud, and sediment, causing upheaval and burying things. In anticipation of this catastrophe, wise men speaking an old language like Aramaic or Sumerian gather to preserve knowledge and send it through time. They seal scientific data, formulas, geometric equations, frequency spectrum information, and instructions for magic spells in a vault or book. This suggests a prediction of a future catastrophic flood event, similar to ancient myths, and the existence of hidden knowledge repositories.

“Then I got the idea of the great flood. Water comes from the west, rain torrential, mud sediment. Upheaval, stuff buried in sediment. The wise men at a table conferred. They want to preserve knowledge and send it through time.” [3:00]
floodcatastropheknowledgepreservationancient
Future Forecasters·made 5/23/2026 Source
CERN experiment causes earthquake and controls masses6:36
Activemedium confidence ScienceTechnologyDisasters

CERN experiment causes earthquake and controls masses

Since May 2026· CERN, Switzerland

The remote viewer links CERN and the Large Hadron Collider to ancient power symbols, occult sciences, and a convergence of planes. They describe a small secure room where a few special people receive a briefing about amplifiers and coils that can set up harmonic waves and conflicting frequencies capable of causing earthquakes. An experiment goes wrong, affecting humanity physically, mentally, and emotionally. A remorseful participant leaves, saying 'This is disgusting. I regret it. I have fear for the sake of humanity.' The prediction is that CERN or a similar facility will intentionally or accidentally trigger earthquakes and manipulate human consciousness.

“There's amplifiers and coils. You can set up a harmonic wave, set up harmonic waves, and conflicting frequencies that can cause earthquakes. ... An experiment goes wrong. They're doing something that affects the masses of humanity, affects physically, mentally, and emotionally.” [6:36]
CERNearthquakeexperimenthumanitycontroloccult
Future Forecasters·made 5/23/2026 Source
AI agents will drive majority of financial decisions0:07
Activemedium confidence TechnologyFinance

AI agents will drive majority of financial decisions

Jan 2025 - Open

The interview argues that an increasing share of financial decisions are already being made by AI agents autonomously and without emotion. This trend is expected to accelerate, moving beyond crypto into traditional markets, fundamentally changing who controls markets as humans cease to be the primary actors. The prediction implies a shift where AI becomes a native participant in the financial fabric, not just a tool.

“An increasing share of financial decisions are now being made, negotiated, and executed by AI agents.” [0:07]
AI agentsfinancial decisionsautonomous tradingmarket controlDeFi
Future Forecasting Group·made 5/23/2026 Source
Intent-based systems will replace manual DeFi execution8:28
Activemedium confidence TechnologyCrypto

Intent-based systems will replace manual DeFi execution

Since May 2026

The speaker predicts that intent-based interfaces, where users define outcomes rather than manually executing trades, will become the norm in DeFi. This will abstract away blockchain complexity, making finance conversational and accessible to both humans and autonomous agents. The fragmentation of chains and protocols will be hidden from users.

“Once the interaction becomes natural, the entire system becomes accessible not just to more humans, but to autonomous agents as well.” [8:28]
intent-basedDeFiabstractionautonomous agentsuser experience
Future Forecasting Group·made 5/23/2026 Source
Tokenization of real-world assets will be a major trend17:36
Activemedium confidence FinanceTechnologyCrypto

Tokenization of real-world assets will be a major trend

Jan 2025 - Open

The interviewee notes that real-world asset (RWA) tokenization is a big subject emerging from blockchain conferences, with plans to integrate it directly into their platform. This indicates a broader industry move toward putting traditional assets on chain, which could accelerate financial inclusion and liquidity.

“Tokenization is a big subject... it's on the agenda and we're going to be touching that directly.” [17:36]
tokenizationreal-world assetsRWADeFiblockchain
Future Forecasting Group·made 5/23/2026 Source
Crypto will disappear as a separate category27:30
Activemedium confidence FinanceTechnology

Crypto will disappear as a separate category

Jan 2026 - Jan 2030

The speaker predicts that within five years, 'crypto' will cease to be a distinct label because it will become fully integrated into mainstream finance, similar to how internet companies are just called companies now. The infrastructure will remain, but the branding will fade.

“I think crypto disappears as a category. Not because it failed, but because it succeeded.” [27:30]
crypto adoptionmainstream financebrandinginfrastructurefuture
Future Forecasting Group·made 5/23/2026 Source
AI agents will introduce new risks like misalignment and flash loan exploits20:07
Activehigh confidence TechnologyFinance

AI agents will introduce new risks like misalignment and flash loan exploits

Since May 2026

The interview highlights under-discussed risks of autonomous AI agents in finance, including agent misalignment, amplified flash loan exploits, and unintended market feedback loops. These issues need to be addressed before mass deployment to prevent systemic failures.

“Things like agent misalignment, amplified flash loan exploits, or unintended market feedback loops that the industry needs to start addressing now.” [20:07]
AI risksflash loansagent misalignmentmarket feedbackDeFi security
Future Forecasting Group·made 5/23/2026 Source
Institutional capital entering DeFi will drive demand for safeguards18:00
Activemedium confidence FinanceCrypto

Institutional capital entering DeFi will drive demand for safeguards

Jan 2025 - Open

As institutional capital moves on-chain, there will be increased demand for safeguards and compliance, as observed at conferences like Paris Blockchain Week. This will lead to an influx of funds into security and protection mechanisms.

“When they're moving on chain, they want to know that it's protected. So there's influx of funds into safeguards.” [18:00]
institutional capitalsafeguardscomplianceDeFisecurity
Future Forecasting Group·made 5/23/2026 Source
Dubai's crypto influx will decrease due to regional conflict15:37
Activelow confidence NewsMilitaryCrypto

Dubai's crypto influx will decrease due to regional conflict

Jan 2025 - Open· Dubai

The speaker notes that despite Dubai remaining a strong hub for crypto, the ongoing war in the region may cause a reduction in the influx of external people and companies, as media portrayal differs from on-ground reality.

“It's just maybe a less of influx will start happening externally because how it's portrayed in the news is different from what people experience on the ground.” [15:37]
Dubaicrypto hubwarinfluxregional conflict
Future Forecasting Group·made 5/23/2026 Source
Chinese children can move objects out of sealed jars via psychokinesis0:22
Activemedium confidence ScienceParanormal

Chinese children can move objects out of sealed jars via psychokinesis

Since May 2026· China

The speaker claims that Chinese researchers have conducted experiments with children who can move pins or small balls out of a sealed glass jar without opening it or making holes, a form of psychokinesis called apporting. This is presented as a real phenomenon based on Chinese research. The prediction implies that such abilities exist and can be demonstrated under controlled conditions.

“They have children where they can put pins or little balls or something into a glass jar that's sealed. And those kids can move the pins and the balls out of the jar without opening the jar, without making holes in the jar” [0:22]
psychokinesisapportChinese researchchildrensealed jar
Inside Remote Viewing·made 5/23/2026 Source
Collective anger toward a boss can cause printer malfunction1:45
Activelow confidence WoowooTechnology

Collective anger toward a boss can cause printer malfunction

Since May 2026

The speaker states that if everyone in an office is angry at the boss, the printer will break down that day. This is attributed to electronics being sensitive to human emotions. It implies a causal relationship between collective emotional states and electronic device failures.

“everybody in the office angry at the boss or something like that, I guarantee you the printer is going down that day.” [1:45]
psychokinesisemotionselectronicsprinteroffice
Inside Remote Viewing·made 5/23/2026 Source
Emotional involvement causes spoons to bend2:09
Activelow confidence ParanormalScience

Emotional involvement causes spoons to bend

Since May 2026

The speaker claims that if a person becomes emotionally involved with a spoon, it will bend—sometimes by itself without physical force. This is presented as an example of psychokinesis triggered by emotion rather than thought. The prediction suggests that metal bending can occur through emotional focus.

“at some point you get emotionally involved with that spoon, it's going to bend.” [2:09]
psychokinesisspoon bendingemotionsmetal
Inside Remote Viewing·made 5/23/2026 Source
Inner Earth civilization possesses original human DNA blueprints0:43
Activelow confidence WoowooScience

Inner Earth civilization possesses original human DNA blueprints

Since May 2026· Antarctica

In the transcript, remote viewer Elizabeth April describes meeting an inner Earth being named Nasani who claims that the inner Earth civilization holds the original DNA blueprints for humanity. Nasani implies that humanity's current DNA has been altered due to 'the fall,' where codes were inserted to cause disease, shortened lifespans, and memory loss. The prediction is that this inner Earth civilization has the technology to restore humans to their original DNA state, potentially reversing these effects. The claim is specific to the existence of an advanced civilization beneath Antarctica with medical technology to alter human genetics.

“We have the knowledge and wisdom to bring you back to your original DNA blueprints.” [0:43]
inner EarthDNAblueprintAntarcticacivilizationrestoration
Elizabeth April·made 5/22/2026 Source
Human DNA was altered by shadow government during 'the fall'1:52
Activelow confidence WoowooScience

Human DNA was altered by shadow government during 'the fall'

Since May 2026

The entity Nasani claims that at some point in human history, codes were inserted into human DNA by shadow government, reptilians, or Draco beings, causing disease, shortened lifespans, and memory loss. This alteration was done for population management. The prediction implies that these alterations are the reason for current human diseases and aging, and that reversing them could restore health and longevity. This is a historical claim about an event called 'the fall' when humanity's original DNA was corrupted by external manipulators.

“When codes were inserted to ensure your demise through disease, shortened lifespans, and lack of memory.” [1:52]
DNA alterationthe falldiseaselifespanmemoryshadow government
Elizabeth April·made 5/22/2026 Source
Synthetic frequency war by 2026
Activelow confidence WoowooTechnologyMilitary

Synthetic frequency war by 2026

Since May 2026

The video claims that a 'frequency war' is being waged by shadow governments or the New World Order using 5G, 6G, HAARP, and radio frequency technologies to artificially lower human vibration and combat the natural ascension process caused by solar flares and Earth's movement toward the center of the universe. This manipulation is predicted to escalate and become a hidden global conflict affecting everyone's consciousness and health. The prediction is based on the speaker's remote viewing and observations of targeted individuals like David Wilcock. No specific timeframes are provided, but the context implies activity is ongoing around the publication date.

“So while the oil crisis is happening and bombs are being dropped and everyone's freaking out, there's a lot going on behind the scenes that you can't even see, but everyone is feeling right now.” [0:00]
synthetic frequenciesfrequency war5G6GHAARPascension
Elizabeth April·made 5/21/2026 Source
Elon Musk will not fund the wrongful death lawsuit20:56
Activemedium confidence NewsPolitics

Elon Musk will not fund the wrongful death lawsuit

Since May 2026· Southampton, UK

In the video, the remote viewer channels that Elon Musk will not actually fund the wrongful death lawsuit against the police in the Henry Nowak case. Despite Musk's public statements offering to fund the suit, the viewer asserts that Musk is all 'smoke and mirrors' and will back down, as he has done in other instances like Reform Party funding. The prediction is based on the viewer's psychic reading of Musk's intentions and past behavior.

“Elon's not going to put any money in. He's all smoke and mirrors.” [20:56]
Elon Muskwrongful deathlawsuitfundingHenry Nowak
Psychic Liz Cross·made 5/21/2026 Source
Officers involved in the case will be dismissed15:58
Activemedium confidence NewsPolitics

Officers involved in the case will be dismissed

Since May 2026· Southampton, UK

The remote viewer predicts that the police officers who responded to the stabbing of Henry Nowak will eventually be dismissed from their positions. The prediction is based on the viewer's psychic probing of the officers and the investigation. The officers are currently desk-bound pending investigation, but the viewer asserts they will be dismissed.

“They will be dismissed. They will be eventually.” [15:58]
policedismissalofficersinvestigationHenry Nowak
Psychic Liz Cross·made 5/21/2026 Source
Victor Degwa will be convicted of involuntary manslaughter without jail time16:48
Activemedium confidence NewsPolitics

Victor Degwa will be convicted of involuntary manslaughter without jail time

Since May 2026· Southampton, UK

The remote viewer predicts that Victor Degwa, the accused in the stabbing death of Henry Nowak, will be convicted of involuntary manslaughter but will not serve any jail time. The viewer claims that the charge will be involuntary manslaughter due to excessive force, but the UK legal system will not impose a prison sentence. This is based on the viewer's psychic communication with the spirit of Henry Nowak and the accused.

“He will get involuntary manslaughter, but without jail time.” [16:48]
Victor Degwainvoluntary manslaughterjailconvictionHenry Nowak
Psychic Liz Cross·made 5/21/2026 Source
Pfizer CEO motivated by non-monetary objective2:14
Activelow confidence NewsHealthPolitics

Pfizer CEO motivated by non-monetary objective

Since May 2026

A remote viewer perceives that the CEO of Pfizer (or a similar pharmaceutical leader) is not primarily driven by profit but by a different, unspecified objective. The description of the CEO as 'calculating' and 'without remorse' suggests he may be pursuing a hidden agenda, potentially involving harm. The context of a manufacturing facility with vials and the feeling of 'dirty deals' implies this could relate to questionable pharmaceutical practices, possibly linked to mRNA technology or other medical products. The prediction is that the CEO's true intention is not financial gain but something more sinister, such as power, control, or advancing a particular ideology. This is based on the subjective impressions of the remote viewer, with no concrete evidence provided.

“Like he the money isn't his objective, it's something else.” [2:14]
Pfizer CEOnon-monetary motivehidden agendapharmaceutical
Future Forecasters·made 5/21/2026 Source
Cancer-like cell division caused by external agents1:35
Activelow confidence ScienceHealthWoowoo

Cancer-like cell division caused by external agents

Since May 2026

The remote viewer describes a vision of cells being attacked by black things, similar to 'mRNA vaccines working with live blood', and a black cloud spreading like cancer. This suggests a prediction that a medical treatment or substance (possibly a vaccine or other biological agent) may cause uncontrolled cell division reminiscent of cancer. The vision includes a manufacturing facility with vials, implying a product is being mass-produced. The viewer interprets this as harmful, with an overall negative economic feeling and the sense that the man in charge is indifferent to harm. The prediction is that a manufactured product could lead to cellular damage or cancer-like effects in individuals. This is based on subjective imagery and vague associations.

“These cells were dividing out of control like you would see with cancer.” [1:35]
mRNA vaccinecancercell divisionharmful effects
Future Forecasters·made 5/21/2026 Source
Antimatter as Future Energy Source24:00
Activelow confidence ScienceTechnologyEnergy

Antimatter as Future Energy Source

Since May 2026

The video claims that antimatter can be harnessed and reprogrammed as an energy source for humanity. However, using it directly for manifestation would backfire because antimatter pulls in the opposite direction, so trying to manifest physical cash would drain bank accounts. The prediction implies that antimatter energy could be developed if reversed or handled correctly, but comes with strong caveats.

“You can use anti-matter as an energy source and reprogram it.” [24:00]
antimatterenergy sourcereprogrammingmanifestation
Psychic Liz Cross·made 5/21/2026 Source
Mirror Universe as Earth's Anti-Counterpart16:00
Activelow confidence ScienceSpaceParanormal

Mirror Universe as Earth's Anti-Counterpart

Since May 2026

The entity claims that there is an anti-universe (mirror universe) that is a direct mirror of Earth, existing in physical form in universe 7. This counterpart has an equal anti-version of everything on Earth. It also states that all matter has a mirror opposite, including Earth, and that the mirror realm is a different level of consciousness outside physical reality.

“It's basically just a mirrored universe. So, it's the opposite. Yes... I would say in universe 7, there's an equal anti-counterpart to everything that we have here.” [16:00]
mirror universeanti-matterparallel universeuniverse 7earth counterpart
Psychic Liz Cross·made 5/21/2026 Source
Big Bang Created by Intentional Explosion26:40
Activelow confidence ScienceSpace

Big Bang Created by Intentional Explosion

Since May 2026

The source entity claims there was a Big Bang, but it was not a random event. It was an explosion caused by knocking two things together to create a large energetic force, a power source used to create things. The Big Bang was necessary to create more energy, and it was an explosion, not an implosion.

“Yes, there was a Big Bang... it was an explosion, but the Big Bang was necessary to create more energy. So, by knocking two things together, you basically create a large energetic force.” [26:40]
Big Bangexplosionenergy creationsource
Psychic Liz Cross·made 5/21/2026 Source
Previous Universe Ended with Light Prevailing30:00
Activelow confidence ScienceSpaceParanormal

Previous Universe Ended with Light Prevailing

Since May 2026

The entity claims that the previous universe (the last universe before this one) ended with everything going to the light. It also states that across millions of universes, the tally is 70% light wins and 30% dark wins.

“Everything went to the light... 30% dark, 70% light.” [30:00]
previous universelight winscosmic cycledark vs light
Psychic Liz Cross·made 5/21/2026 Source
Antimatter Predates the Big Bang25:20
Activelow confidence ScienceSpace

Antimatter Predates the Big Bang

Since May 2026

The entity describes antimatter as primordial, existing before the Big Bang and before this universe existed. It also states that antimatter is infinite and has a line of infinity in this realm, and that matter and antimatter are equal in this universe even though we only see a fraction.

“Oh yeah, definitely because it existed before this universe existed... Infinity in this realm? Yes... matter and anti-matter are equal in this universe even though we only see a fraction.” [25:20]
antimatterprimordialBig Banginfinitymatter equality
Psychic Liz Cross·made 5/21/2026 Source
Market liquidity shift from gold and tech stocks to SpaceX7:58
Activemedium confidence Finance

Market liquidity shift from gold and tech stocks to SpaceX

Since May 2026

Liz predicts that the massive influx of money into the SpaceX IPO will come from selling other assets, particularly gold and some tech stocks that have been underperforming. However, she believes serious investors have already set aside cash for this, so the market overall will not experience a major downturn. The S&P 500 will remain high, and the IPO will not mark a local top.

“Massive liquidity drain to bring it up to this valuation... it could be coming from gold.” [7:58]
liquiditygoldtech stocksSpaceXmarket shift
Psychic Liz Cross·made 5/20/2026 Source
Silver price range over next three months11:58
Activemedium confidence Finance

Silver price range over next three months

May 2026 - Aug 2026

Liz predicts that silver's performance over the next three months will be mediocre, rating it a 4 out of 10. She expects the price to remain between $65 and $80 per ounce, with a high below $90 and likely below $80, and a low between $65 and $70. The current price is $76, so the prediction indicates a slight decline or sideways movement.

“It's a four. ... It's going to be a little lower, yeah.” [11:58]
silverpriceforecastmetalscommodities
Psychic Liz Cross·made 5/20/2026 Source
Disclosure will cause chaos among religious individuals1:05
Activemedium confidence PoliticsParanormal

Disclosure will cause chaos among religious individuals

Since May 2026

Elizabeth April predicts that the disclosure of extraterrestrial life will throw the general population, particularly those who have been 'asleep' and deeply religious, into chaos. This will prompt intense questioning of long-held beliefs, especially for those with strong religious backgrounds. The prediction is made in the context of ongoing debates about how disclosure will be framed by different factions.

“No matter what, disclosure is going to throw everyone, especially the ones who have been asleep, into chaos.” [1:05]
disclosureextraterrestrialchaosreligionawakening
Elizabeth April·made 5/20/2026 Source
Extraterrestrials are part of human evolution0:52
Activelow confidence ParanormalScience

Extraterrestrials are part of human evolution

Since May 2026

The speaker asserts that extraterrestrials exist, have been part of human evolution since the dawn of humanity, and include both good and bad entities. This is presented as a fact rather than a prediction, but it implies a future where this truth is accepted. The claim is part of her worldview and not presented as a specific forecast.

“Extraterrestrials exist. They were a part of our evolution. They've been here since the dawning of humanity.” [0:52]
extraterrestrialsevolutionhumanityancient
Elizabeth April·made 5/20/2026 Source
Both good and bad disclosure narratives will happen simultaneously2:00
Activelow confidence Paranormal

Both good and bad disclosure narratives will happen simultaneously

Since May 2026

April predicts that two opposing disclosure narratives (one positive/ascension-focused, one negative/fear-based) will occur at the same time, and that individual belief will determine which reality people experience. This is a metaphysical claim based on collective focus creating reality.

“Both sides are leveraging something like cosmic disclosure for their benefit. ... Which one will you choose?” [2:00]
disclosurebeliefrealitycollective
Elizabeth April·made 5/20/2026 Source
Secret society planning global domination via strategic alliance0:04
Activelow confidence PoliticsParanormal

Secret society planning global domination via strategic alliance

Since May 2026· United States (implied)

A remote viewing session claims to perceive a secret society or group (described as having an 'American flavor' and 'skull and bones feel') that is in the early stages of planning a global domination strategy. The plan involves a 'strategic freeway alliance' and covert discussions among powerful individuals, including two male figures over 50 years old, one second-in-command and another highly placed. The prediction suggests that this group is manipulating power structures through deals and back-channel communications to achieve global impact, with implications for future power struggles.

“It's all about a long-term plan to do with the future... domination... a strategic freeway alliance.” [0:04]
secret societyglobal dominationstrategic alliancepower strugglecovert discussions
Future Forecasters·made 5/20/2026 Source
No prediction made
Activelow confidence

No prediction made

Since May 2026

This transcript is an instructional guide on stage one of technical remote viewing, specifically the ideogram. It does not contain any concrete, falsifiable predictions about public events, markets, science, or world affairs.

Psychic Recon - James Vitale·made 5/20/2026 Source
Hidden ancient knowledge about psychedelic mushrooms8:50
Activelow confidence ScienceParanormal

Hidden ancient knowledge about psychedelic mushrooms

Since May 2026

The remote viewing session suggests that there are ancient texts, possibly from the 3rd century, that describe the effects of the mushroom Lanmaoa asiatica, including the vision of small people. This implies that historical knowledge about this mushroom's psychoactive properties may be more extensive than publicly known, possibly including hidden or secret books kept by trusted individuals. The prediction is based on subjective remote viewing data and references to existing historical texts, but no specific future event is predicted.

“there is a reference to this mushroom in a third century Taoist text where... 'Or in the mountains one sees little people riding chariots and horses, 18 to 20 cm tall.'” [8:50]
mushroompsilocybinhallucinationgnomesancientsecret
Second House RV·made 5/20/2026 Source
Mushroom Lanmaoa asiatica may have metaphysical properties2:00
Activelow confidence ScienceParanormal

Mushroom Lanmaoa asiatica may have metaphysical properties

Since May 2026

The transcript suggests that the mushroom Lanmaoa asiatica might not just cause hallucinations but could have a 'metaphysical' aspect, potentially allowing users to access a different reality or frequency where gnomes exist. This is framed as a speculation discussed by the remote viewers, not a concrete prediction. No specific future event is described.

“I was wondering, is this mushroom kind of like DMT where this plugs you into a particular frequency or something where the gnomes live?” [2:00]
mushroomDMTfrequencygnomesmetaphysical
Second House RV·made 5/20/2026 Source
AI-driven security exploits to increase dramatically19:00
Activehigh confidence Technology

AI-driven security exploits to increase dramatically

Jan 2025 - Open

Zach Herbert predicts that AI tools will make security exploits more common, both in terms of technical OS-level exploits (like Mythos) and social engineering attacks (SIM swapping, account takeovers). He states that AI models like Mythos, which are currently in research preview, will become more widespread over time, leading to a surge in zero-day vulnerabilities and hacks. This will affect all users of internet-connected devices, especially those storing crypto or sensitive data on phones. The prediction implies a worsening cybersecurity landscape over the coming months and years, requiring users to move critical data off phones.

“I think with the AI tools it's going to happen even more because the AI tools in addition to finding exploits... that's going to get more common with these AI models like Mythos.” [19:00]
AIsecurity exploitsMythoszero-dayhacking
Future Forecasting Group·made 5/20/2026 Source
Widespread realization to move sensitive data off phones within a few years21:10
Activemedium confidence Technology

Widespread realization to move sensitive data off phones within a few years

Jan 2025 - Jan 2028

Zach predicts that over the next couple of years, most people will realize they need to move critical security data (2FA codes, crypto keys, etc.) off their smartphones due to escalating AI-driven threats. This is a societal shift in cybersecurity awareness and behavior, driven by increasing exploits targeting phones.

“I think over the next couple of years, everyone's going to realize that you're going to have to get that stuff off your phone.” [21:10]
cybersecuritysmartphone security2FAdata sovereigntyAI threats
Future Forecasting Group·made 5/20/2026 Source
Harvest now, decrypt later attacks are ongoing29:40
Activemedium confidence TechnologyMilitaryPolitics

Harvest now, decrypt later attacks are ongoing

Since May 2026

Zach asserts that intelligence agencies are already collecting petabytes of encrypted data with the intention of decrypting it retroactively once quantum computers become available. This is an existing practice that will have future consequences for privacy and security when quantum computing matures.

“There's this idea of information harvesting, intelligence agencies collecting petabytes of data so they can hold on to them until they have a quantum computer available, in which case they can retroactively go back, try to decrypt everything.” [29:40]
quantum computingharvest now decrypt laterintelligence agenciesdata harvesting
Future Forecasting Group·made 5/20/2026 Source
Bitcoin will survive quantum computing via upgrades31:00
Activemedium confidence TechnologyFinance

Bitcoin will survive quantum computing via upgrades

Jan 2025 - Jan 2035

Zach predicts that Bitcoin will adapt to quantum computing threats by introducing new post-quantum address formats, allowing users to move coins to secure addresses. He states this will happen in the coming years and that Bitcoin will be fine, contrasting with fears that quantum computers will break Bitcoin.

“Bitcoin will figure it out. There'll be some upgrades in the coming years where... there'll be a new post-quantum address format.” [31:00]
Bitcoinquantum computingpost-quantumcryptocurrencyupgrade
Future Forecasting Group·made 5/20/2026 Source
Significant quantum computer over a decade away28:20
Activehigh confidence TechnologyScience

Significant quantum computer over a decade away

Since May 2026

Zach states that viable quantum computers are still over a decade, if not decades, away. He cites research indicating the physical hardware is six to nine orders of magnitude from being practical. This is a counterpoint to fears of imminent quantum disruption.

“We're over a decade away, if not decades away, from any kind of viable quantum computer.” [28:20]
quantum computingtimelinehardwareviability
Future Forecasting Group·made 5/20/2026 Source
AI agents will require dedicated hardware for human approval36:00
Activemedium confidence Technology

AI agents will require dedicated hardware for human approval

Jan 2025 - Jan 2028

Zach predicts that as AI agents become more autonomous, there will be a need for dedicated hardware devices (like hardware wallets) to intercept high-stakes actions (e.g., large money transfers) and require human approval. This will become a standard security paradigm within a few years, especially for enterprise and early adopters.

“You need to get all your important approvals outside of the blast radius... We think that you need to find a way to route those most important approvals onto a device that's outside of the blast radius.” [36:00]
AI agentshuman approvalhardware securityblast radiusautonomy
Future Forecasting Group·made 5/20/2026 Source
New zero-day exploits will emerge weekly over the next few years56:00
Activehigh confidence Technology

New zero-day exploits will emerge weekly over the next few years

Jan 2025 - Jan 2028

Zach predicts that over the next few years, there will be new zero-days and exploits every week due to the cat-and-mouse game between AI models and operating systems. This will create a challenging security environment for all digital users.

“There's going to be new zero-days and exploits and hacks every like week over the next few years.” [56:00]
zero-dayexploitscybersecurityAIfrequency
Future Forecasting Group·made 5/20/2026 Source
Societal bifurcation into sovereign individuals and mass consumers57:00
Activemedium confidence TechnologyPolitics

Societal bifurcation into sovereign individuals and mass consumers

Jan 2026 - Jan 2030

Zach predicts a growing divide between a top 10-20% of 'sovereign individuals' who take control of their digital security, data, and finances (using self-custody and local AI), and the masses who remain dependent on centralized services, addicted to AI-generated content, and subject to social credit systems. This bifurcation will solidify over the next 3-5 years.

“I think there's going to be some bifurcation. I think you're going to have that group of folks at the top 10 to 20% that are actually doing all that... and then there's going to be kind of the masses that are probably addicted to the next gen Tik Tok.” [57:00]
bifurcationsovereign individualdigital divideAIsocial credit
Future Forecasting Group·made 5/20/2026 Source
Gold price to reach $6,00010:29
Activemedium confidence Finance

Gold price to reach $6,000

Jan 2026 - Dec 2026

Marty Hibbs predicts that gold will reach $6,000 later this year, after breaking through the $5,000 resistance level. The prediction is based on technical analysis that suggests once $5,000 is cleared, a much higher high into the sixes is likely.

“possibility it could be as high as 6,000 sometime this year” [10:29]
goldprice prediction$6,000
Future Forecasting Group·made 5/19/2026 Source
Silver price to hit new all-time high11:30
Activemedium confidence Finance

Silver price to hit new all-time high

Jan 2026 - Dec 2026

Marty Hibbs predicts that silver will trade between $100 and $120 before the end of the year, challenging its all-time high. He expects silver to get close to that level but is uncertain if it will break through, though he is confident it will reach the $100-120 range.

“I expect us to be back between the 100 120 before the end of this year for certain” [11:30]
silverprice predictionall-time high
Future Forecasting Group·made 5/19/2026 Source
IRS will audit crypto transactions in real time using AI7:48
Activehigh confidence TechnologyFinance

IRS will audit crypto transactions in real time using AI

Since May 2026· US

The speaker claims that the IRS will use AI to audit cryptocurrency transactions in real time, making it impossible to evade taxes. This is presented as a certainty for crypto investors, implying that compliance is mandatory.

“they're going to audit you in real time using AI. There will be no escaping that.” [7:48]
IRSAI auditcrypto tax
Future Forecasting Group·made 5/19/2026 Source
Blistering run-up in crypto market8:56
Activelow confidence CryptoFinance

Blistering run-up in crypto market

Since May 2026

The speaker predicts a forthcoming 'blistering run-up' in cryptocurrencies, describing it as 'unreal'. This implies a significant bull market is expected soon.

“There's going to be it's going to be a blistering run-up when it comes. It's going to be unreal.” [8:56]
cryptobull runblistering
Future Forecasting Group·made 5/19/2026 Source
Major planetary changes imminent0:13
Activelow confidence NewsPolitics

Major planetary changes imminent

Since May 2026

The speaker states that the world is 'getting really close' to the beginning of major changes on the planet. This is a vague prediction of significant global transformations occurring in the near future, though no specific events or timeline are provided.

“we're getting really close to the beginning of major changes in the planet, like, really close.” [0:13]
major changesplanetimminent
Farsight·made 5/19/2026 Source
Disclosure process accelerating2:42
Activemedium confidence ScienceSpaceParanormal

Disclosure process accelerating

Since May 2026· Mars (Cydonia)

The speaker claims that the disclosure process regarding extraterrestrial phenomena is ongoing and accelerating, with the Cydonia region of Mars being a key element. He suggests that remote viewing data reveals an ancient Martian civilization destroyed by a cataclysm, implying that this knowledge will become more relevant and widely accepted soon.

“This one is really important because it's a huge element in the disclosure process, which is what the heck's been going on on Mars.” [2:42]
disclosureMarsCydoniacivilizationremote viewing
Farsight·made 5/19/2026 Source
Cydonia civilization destroyed by cataclysm7:05
Activemedium confidence ScienceSpaceDisasters

Cydonia civilization destroyed by cataclysm

Since May 2026· Mars

According to remote viewing data, the Martian civilization in Cydonia was destroyed by a planetary cataclysm involving a massive kinetic impact and megaflood. This event left only eroded peaks of their monuments. The prediction implies that this hidden history will be acknowledged or discovered by the public in the future.

“A devastating kinetic impact slammed into the planet. A megaflood of dark water, mud, and planetary debris crashed over the civilization.” [7:05]
CydoniacataclysmimpactmegafloodMars
Farsight·made 5/19/2026 Source
Asteroid belt originated from destroyed planet11:33
Activelow confidence ScienceSpace

Asteroid belt originated from destroyed planet

Since May 2026· Asteroid belt

The speaker asserts, citing astronomer Thomas Van Flandern, that the asteroid belt is the remains of a former planet that exploded, not primordial debris. This contradicts mainstream astronomy and suggests that this truth will eventually be accepted.

“There has to have been a planet there. And Thomas van Flandern has gone through a zillion reasons why the asteroid belt is the remains of a former planet that was destroyed, that was, that exploded.” [11:33]
asteroid beltplanet explosionThomas van FlandernMaldek
Farsight·made 5/19/2026 Source
UFO stealth technology can be circumvented with consumer cameras28:48
Activemedium confidence TechnologyParanormal

UFO stealth technology can be circumvented with consumer cameras

Since May 2026

The speaker claims that extraterrestrial spacecraft use stealth technology that can be bypassed by using infrared cameras at 120 frames per second, with specific post-processing techniques. He states that one can capture clear images of UFOs using commercially available equipment, implying that this method will allow the public to independently verify UFO existence.

“we actually show people how to actually take video recordings of cloaked stealth UFOs, extraterrestrial spacecraft, using cameras that they can buy themselves and process themselves.” [28:48]
UFOstealthinfraredcameraDIY
Farsight·made 5/19/2026 Source
Potential disclosure of UFO reality in summer 202644:50
Activelow confidence NewsParanormalPolitics

Potential disclosure of UFO reality in summer 2026

Jun 2026 - Aug 2026

The speaker mentions that 'there may be some disclosure this summer' (summer 2026) regarding UFOs, but expresses skepticism about the source (media/authorities) and suggests that any such disclosure may be limited and manipulative.

“there may be some disclosure this summer, we don't know, but that's what we're being told” [44:50]
disclosureUFOsummer2026media
Farsight·made 5/19/2026 Source
Maduro trial will reveal election fraud scheme40:58
Activelow confidence PoliticsNews

Maduro trial will reveal election fraud scheme

Since May 2026· United States, Venezuela

The speaker references an interview in which a deal was made with Venezuelan President Maduro: he and his wife would go free if they confess to running an election-stealing process in the United States and elsewhere. The speaker suggests that this confession may eventually come to light, potentially proving widespread election fraud.

“a deal has been made, and he will be given an option. He and his wife can go free if they confess to how they were running the election stealing process in the United States and other places.” [40:58]
Maduroelection fraudconfessiondealVenezuela
Farsight·made 5/19/2026 Source
Elections are routinely flipped worldwide39:26
Activelow confidence PoliticsNews

Elections are routinely flipped worldwide

Since May 2026· Worldwide

The speaker claims that new evidence shows elections everywhere are routinely flipped, using software from companies owned by Maduro supporters, and that intelligence agencies now have the capability to manipulate elections globally. This is presented as a systemic problem that will continue or be exposed.

“the new evidence that's coming out is that this is routine now to flip elections.” [39:26]
electionflippingfraudintelligenceMaduro
Farsight·made 5/19/2026 Source
2026-2028 global transition phase0:21
Activelow confidence PoliticsEnvironment

2026-2028 global transition phase

Jan 2026 - Dec 2028

The video claims that 2026 is a year of transition from 'fear frequency' to 'love frequency' (old earth to new earth), and this transition phase extends into 2028. The prediction is that during this period, collective-level challenges will continue or intensify for those who do not adapt personally (e.g., by learning life lessons). The reasoning is based on spiritual or metaphysical concepts of ascension and awakening. The consequence is that global conditions will remain rough, and individuals who resist change will face increasing difficulties.

“2026 is the year of transition. And this transition phase actually goes into 2028.” [0:21]
2026transitionascensionglobalcollectivenew earth
Elizabeth April·made 5/19/2026 Source
AI-generated government takeover1:22
Activemedium confidence TechnologyPolitics

AI-generated government takeover

Since May 2026

The video describes a future scenario where an AI-generated government or technocratic system takes over, with a leader who is robotic in nature. People will be unaware that what they perceive as real is actually AI-generated or robotic. This is depicted as a long-in-the-making, underground technological takeover that reduces the need for humans, as AI performs tasks cheaper, faster, and more efficiently. The prediction implies that society will be conditioned to accept artificial everything, losing touch with human creativity and inspiration.

“It's more like a technological takeover. The occupation element here was more technocratic. Like they're being taken over by an AI-generated government or something like that. People won't even know the difference.” [1:22]
AI governmenttechnocratic takeoverAI-generated leaderrobotic leadertechnological takeover
Future Forecasters·made 5/19/2026 Source
Discovery of a hidden entrance to Inner Earth in Antarctica1:33
Activelow confidence WoowooParanormal

Discovery of a hidden entrance to Inner Earth in Antarctica

Since May 2026· Antarctica

The remote viewer claims to have found a giant hole in Antarctica, covered up by Google, satellites, and NASA, which serves as a doorway to a hollow Earth civilization. This civilization has its own ecosystem with different plants, beings, and societies. The military base and restrictions around Antarctica are said to be in place to conceal this entrance and prevent interaction between the inner Earth beings and humanity. The prediction implies that this hidden realm exists and will eventually be revealed or become relevant to world events.

“This giant hole in Antarctica is the biggest doorway to hollow Earth or inner Earth civilizations.” [1:33]
Antarcticahollow Earthinner Earthdoorwaymilitary basecover-up
Elizabeth April·made 5/18/2026 Source
Future contact between inner Earth and surface civilizations2:33
Activelow confidence WoowooParanormal

Future contact between inner Earth and surface civilizations

Since May 2026· Antarctica (inner Earth)

The remote viewer suggests that the inner Earth civilization has a perspective on Earth's current events and the future, particularly regarding potential communication or interaction with surface humanity. The prediction implies that this contact may happen in the future, as the beings inside have beliefs about what is going on and what lies ahead. The video promotes a separate video for more details, indicating that this is a broader narrative about an upcoming revelation or encounter.

“I got the inside scoop on what they believe is going on on planet Earth right now and what the future looks like, especially when it comes down to the inner Earth civilization.” [2:33]
inner Earthcontactfuturecivilizationcommunication
Elizabeth April·made 5/18/2026 Source
Inner Earth Civilization Disclosure24:53
Activemedium confidence SciencePoliticsParanormal

Inner Earth Civilization Disclosure

Since May 2026· Antarctica

Elizabeth April predicts that the existence of a hidden inner Earth civilization beneath Antarctica will be disclosed to the public. She claims that a giant hole in Antarctica leads to a hollow Earth with a tropical-like environment, inhabited by various beings including hybrid Sirian elementals. The prediction states that restrictions around the entrance to inner Earth are being lifted, and that inner Earth beings are working with alternative organizations for disclosure. The disclosure would reveal the truth about humanity's original DNA blueprints and the historical 'fall' of humanity involving inserted codes causing disease, shortened lifespans, and memory loss. The prediction is based on her remote viewing session and her conversation with a being named Nasani.

“Disclosure.” [24:53]
disclosureinner EarthAntarcticaDNA blueprintshollow Earth
Elizabeth April·made 5/18/2026 Source
Strange Creatures Escaping from Inner Earth17:07
Activelow confidence ParanormalScience

Strange Creatures Escaping from Inner Earth

Since May 2026· Antarctica

Elizabeth April predicts that strange flying creatures may escape from inner Earth via the Antarctic opening. She describes these as possibly prehistoric or dragon-like creatures. This could lead to sightings by people on boats or cruise ships near Antarctica. The prediction is based on her remote viewing but presented as a possibility, not a certainty.

“Strange creatures possibly escaping from inner Earth in Antarctica.” [17:07]
creaturesinner EarthAntarcticaprehistoricdragon
Elizabeth April·made 5/18/2026 Source
Restrictions on Inner Earth Lifted16:18
Activelow confidence PoliticsParanormal

Restrictions on Inner Earth Lifted

Since May 2026· Antarctica

Elizabeth April claims that restrictions around the inner Earth opening in Antarctica are being lifted. She does not specify who is lifting them or why, but links it to shifting power dynamics and the old world falling. This could enable more movement in and out of inner Earth, potentially leading to increased contact or sightings.

“Restrictions around inner Earth opening are getting released.” [16:18]
restrictions liftedinner EarthAntarcticapower shift
Elizabeth April·made 5/18/2026 Source
Cover-Up of Antarctica Hole by Satellites10:43
Activelow confidence PoliticsScienceTechnology

Cover-Up of Antarctica Hole by Satellites

Since May 2026· Antarctica

Elizabeth April predicts that satellite images and maps from Google, NASA, and other agencies are being doctored to hide a large hole in Antarctica that leads to inner Earth. She claims this cover-up fuels conspiracy theories about an ice wall and flat Earth. The military base beside the hole enforces the secrecy.

“Google satellite, Google Maps or Earth and NASA, like all of the images of the planet are always covering stuff up all around Antarctica, okay?” [10:43]
cover-upsatellite imagesAntarcticaNASAholeinner Earth
Elizabeth April·made 5/18/2026 Source
Inner Earth Outlets Worldwide17:58
Activelow confidence ParanormalScience

Inner Earth Outlets Worldwide

Since May 2026· Worldwide

Elizabeth April predicts that there are multiple gateways or 'outlets' to inner Earth across the globe, including under the oceans. She suggests that movement through these outlets is occurring, with restrictions being lifted. This could imply that inner Earth beings are becoming more active globally.

“There's inner Earth outlets all over the world.” [17:58]
inner Earthgatewaysoutletsglobaloceans
Elizabeth April·made 5/18/2026 Source
Ancient Mayan Civilization in Inner Earth15:08
Activelow confidence ScienceParanormal

Ancient Mayan Civilization in Inner Earth

Since May 2026· Inner Earth

Elizabeth April predicts that the ancient Mayan civilization, along with other indigenous groups, moved underground to inner Earth to avoid cataclysmic events on the surface. She suggests they still exist there today, preserving their knowledge and culture.

“The ancient Mayan civilizations actually went underground to live in the inner Earth civilizations in order to avoid cataclysmic events.” [15:08]
Mayaninner Earthcivilizationcataclysmsunderground
Elizabeth April·made 5/18/2026 Source
Humanity's Original DNA Restoration25:08
Activelow confidence ScienceParanormal

Humanity's Original DNA Restoration

Since May 2026

Elizabeth April predicts that inner Earth beings possess the knowledge and technology to restore humanity's original DNA blueprints, which were corrupted by the 'fall'—insertion of codes causing disease, shortened lifespans, and memory loss. She implies that this restoration is possible if humanity collectively asks to be returned to its original state.

“We have the knowledge and wisdom to bring you back to your original DNA blueprints before the fall.” [25:08]
DNAblueprintsrestorationinner Earthhumanityfall
Elizabeth April·made 5/18/2026 Source
Hantavirus outbreak will escalate into a significant public health threat8:30
Activemedium confidence HealthDisastersNews

Hantavirus outbreak will escalate into a significant public health threat

Since May 2026

The video discusses a hantavirus outbreak linked to a cruise ship, with six confirmed infections, three deaths, and one person in ICU in South Africa. The hosts claim that the virus is likely a variation of the Andean strain, which has a higher mortality rate and is easily transmittable human-to-human. They predict this will become a major problem, similar to COVID-19, based on remote viewing of Bill Gates and an ex-CIA officer who believe it is a credible threat and that it is being manufactured. However, no specific timeframe or location beyond the current outbreak is given.

“He definitely believes that it's a problem.” [8:30]
hantaviruspandemicoutbreakAndean strainmanufactured
Psychic Liz Cross·made 5/18/2026 Source
Bill Gates will profit from hantavirus through pharmaceutical investments6:50
Activemedium confidence FinanceHealthNews

Bill Gates will profit from hantavirus through pharmaceutical investments

Since May 2026

According to the remote viewing session, Bill Gates has plans to capitalize on the hantavirus event through investments, particularly in pharmaceutical companies. The transcript states that he is 'all over pharmaceutical investments' and intends to make money from the situation. This prediction implies that Gates will benefit financially as the outbreak unfolds, similar to allegations made during the COVID-19 pandemic. No specific timeline or financial details are provided.

“Oh, he's all over pharmaceutical investments. Yes.” [6:50]
Bill Gatesinvestmentpharmaceuticalprofithantavirus
Psychic Liz Cross·made 5/18/2026 Source
Illegal underground labs are conducting unauthorized virus research16:50
Activelow confidence ScienceHealthMilitary

Illegal underground labs are conducting unauthorized virus research

Since May 2026· South Africa, South America, Mexico

The ex-CIA officer (via Liz) reveals that pharmaceutical companies and other entities operate illegal underground labs disguised as warehouses. These labs conduct unauthorized experimentation on deadly pathogens, avoiding regulatory oversight. The smuggling of pathogens by NIH-linked scientists is linked to supplying these labs. The prediction is that such illegal research is widespread and will continue, particularly in South Africa, South America, and Mexico, enabling activities that would be considered war crimes if done on US soil.

“They were paid a lot of money to smuggle this stuff, this virus or whatever it is to go send to this illegal lab.” [16:50]
illegal labspathogen smugglingNIHFauciwar crimes
Psychic Liz Cross·made 5/18/2026 Source
High-profile individual faces public identity challenge5:18
Activemedium confidence PoliticsNewsParanormal

High-profile individual faces public identity challenge

May 2026 - Open

The remote viewer describes a scenario involving a powerful individual who must undergo a rigorous verification process to prove their identity, origins, and pedigree, possibly in a court or committee setting. The prediction suggests that this person may be a high-level figure or from a specific family, facing accusations of false representation or being part of an association under scrutiny. The outcome is uncertain, but the viewer senses that the individual may fail or be replaced, indicating a potential downfall or failure to secure a desired claim or position.

“there is a notion here that the amount of destruction may be larger than anticipated” [5:18]
identity verificationpedigreefalse representationcommittee scrutinyreplacement
Future Forecasters·made 5/18/2026 Source
MH370 Found in Large Pieces in Southern Indian Ocean59:07
Activemedium confidence DisastersNews

MH370 Found in Large Pieces in Southern Indian Ocean

Since May 2026· southern Indian Ocean

Remote viewing data suggests the aircraft impacted the ocean at low speed with flaps extended, resulting in breakup into two or three large pieces. Debris and bodies sank quickly, explaining lack of floating wreckage. The predicted location is likely in the southern Indian Ocean, based on known ping data and deliberate avoidance of radar.

“whenever the aircraft will found, uh it will be mostly in large pieces. Uh large pieces mean that uh because it's impacted at a low energy state, uh it become uh there was breakage of the aircraft.” [59:07]
MH370wreckagelow-speed impactflaps downIndian Ocean
Dr. Q·made 5/18/2026 Source
Major planetary changes imminent1:42:02
Activemedium confidence NewsPoliticsScience

Major planetary changes imminent

Since May 2026

According to Courtney Brown, we are getting really close to the beginning of major changes on the planet. These changes are described as imminent, with the speaker emphasizing that we are 'really close' to the start of significant transformations. The prediction is based on remote viewing data and the speaker's general sense of upcoming events, but no specific details about the nature of these changes are provided.

“We're getting really close to the beginning of major changes in the planet. Like really close.” [1:42:02]
major changesplanetaryimminenttransformation
Farsight·made 5/18/2026 Source
Disclosure of extraterrestrial involvement this summer1:47:41
Activelow confidence PoliticsScienceParanormal

Disclosure of extraterrestrial involvement this summer

Jun 2026 - Aug 2026

Courtney Brown mentions that there may be some disclosure about UFOs and extraterrestrials this summer, but he caveats that this is being told by media people, not by the 'good ETs' that work with Farsight. The prediction suggests that official disclosure could occur, which would then reveal that government statements about extraterrestrials since the 1940s have been lies. However, Brown expresses skepticism about the completeness of such disclosure.

“As soon as there's any disclosure at all and there may be some disclosure this summer. We don't know but that's what we're being told.” [1:47:41]
disclosureUFOextraterrestrialsummergovernment
Farsight·made 5/18/2026 Source
Election hacking revelations from Maduro trial2:23:00
Activelow confidence PoliticsMilitary

Election hacking revelations from Maduro trial

Since May 2026· United States, Venezuela

Courtney Brown claims new evidence shows that elections are routinely stolen using software from companies owned by supporters of Maduro in Venezuela. According to an interview with Ralph Pezzullo, the intelligence agencies have the software and flip elections worldwide. A deal was allegedly made with Maduro to confess to election-stealing in exchange for freedom for him and his wife, but Brown believes the intelligence agencies will delay and cancel the release of this information.

“A deal was made with Maduro who was captured in Venezuela and brought to New York and said, 'Look, wait until the trial comes out from Maduro and he will a deal has been made and he will be given an option. He can he and his wife can go free if they confess to how they were running the election stealing process in the United States and other places.'” [2:23:00]
electionhackingMaduroVenezuelaintelligence
Farsight·made 5/18/2026 Source
Farsight to release two Newsphere episodes per week1:42:09
Activehigh confidence Technology

Farsight to release two Newsphere episodes per week

May 2026 - Open

Courtney Brown announces that Farsight will be producing two 'Newsphere' episodes per week, with one shown in the weekly spotlight and the other two (presumably three total, but context suggests two per week with one in spotlight) available on farsightprime.com. These are five-minute AI-generated videos summarizing past remote viewing projects objectively. This is a regular production schedule moving forward.

“This is something that we're going to be doing twice a week, and one of those new sphere videos is going to be in the spotlights once a week.” [1:42:09]
NewsphereAI videoweeklyFarsightremote viewing
Farsight·made 5/18/2026 Source
Shadowbanning of Farsight on major platforms2:34:34
Activehigh confidence TechnologyPolitics

Shadowbanning of Farsight on major platforms

Since May 2026

Courtney Brown states that Farsight is shadowbanned on Google and YouTube, meaning users cannot find Farsight unless they directly search for it. This is presented as a current state of affairs implying ongoing censorship by tech platforms against alternative viewpoints.

“We are shadowbanned on Google we are shadowbanned on YouTube you can find us if you directly search for farsight but otherwise you can't find us.” [2:34:34]
shadowbanGoogleYouTubecensorshipFarsight
Farsight·made 5/18/2026 Source
Tokenization of Stock Exchanges2:07
Activemedium confidence FinanceTechnology

Tokenization of Stock Exchanges

Since May 2026

The video predicts that the New York Stock Exchange and global finance will undergo a major transformation through tokenization. All stocks will be tokenized, allowing 24/7 trading via smart contracts and blockchain technology. The former NYSE CEO Jeff Sprecher is cited as a source. This will change legal constructs, settlement processes, and bankruptcy rules. The prediction is that this new system will attract trillions in investment.

“all stocks are going to be tokenized you will be able to buy a portion of a stock any hour any day it'll be 24/7 trading” [2:07]
tokenizationNYSEblockchainsmart contracts24/7 trading
Future Forecasting Group·made 5/17/2026 Source
Fed Money Injection of $26.3 Billion4:10
Activehigh confidence FinancePolitics

Fed Money Injection of $26.3 Billion

May 2026 - Open· United States

The video claims that the Federal Reserve, under new Chair Kevin Warsh, will inject $26.3 billion into the markets starting Monday. This prediction is based on a remote viewing hit by Edward Reardon about an increase in money supply. The injection is described as 'turning on the money printers' and is expected to be inflationary.

“Those guys will inject 26.3 billion dollars into the markets starting Monday.” [4:10]
Federal Reservemoney supplyinjectionKevin Warshinflation
Future Forecasting Group·made 5/17/2026 Source
Personal data monetization via blockchain will become mainstream27:00
Activemedium confidence FinanceCryptoTechnology

Personal data monetization via blockchain will become mainstream

Since May 2026

The speaker predicts that the financial system will shift to blockchain and crypto, enabling individuals to own and monetize their personal data by selling it on a marketplace. This will be driven by Gen Z and will upend current advertising and data-collection models.

“I want to have my data on a marketplace where I can make money and sell it if I choose to... We are going to be based on a financial world of crypto and blockchain.” [27:00]
data ownershipblockchaincryptopersonal data marketprivacy
Future Forecasting Group·made 5/17/2026 Source
Global education will be transformed by AI tutors by late 2020s52:00
Activemedium confidence ScienceTechnology

Global education will be transformed by AI tutors by late 2020s

Since May 2026

The speaker predicts that AI will revolutionize education by providing personalized, engaging tutoring to children. Schools and colleges may become largely obsolete as AI can teach any subject using a student's interests (e.g., soccer, firefighting).

“The AI will teach them everything based on being a fireman or whatever, and the kids learning goes through the roof... we just solved the educational problem globally.” [52:00]
AI educationpersonalized learningschool disruptionchildrenAI tutor
Future Forecasting Group·made 5/17/2026 Source
Robot repair and recycling will become multi-billion dollar industries48:00
Activehigh confidence TechnologyFinance

Robot repair and recycling will become multi-billion dollar industries

Since May 2026

The speaker predicts that as humanoid robots become widespread, new industries will emerge for robot repair and parts recycling. These are 'green field' opportunities with no existing competition, offering local, regional, and global business openings.

“These new robots are going to be break down. So there's going to be a huge new business in repairing robots... we need to recycle those robots... another green field industry.” [48:00]
robot repairrobot recyclingnew industrybusiness opportunityhumanoid robots
Future Forecasting Group·made 5/17/2026 Source
Crypto market will experience a major explosion after current dip39:15
Activemedium confidence FinanceCrypto

Crypto market will experience a major explosion after current dip

Since May 2026

The speaker predicts that the current crypto market downturn is a temporary dip before a large explosion upward. The financial system must transition to blockchain and crypto, and this will happen despite opposition.

“The crypto market now is really in bad shape. That's the dip before the explosion. The new financial markets of the world cannot continue the way they are. They must go blockchain.” [39:15]
crypto marketdipexplosionblockchainfinancial system
Future Forecasting Group·made 5/17/2026 Source
Remote telesurgery will become globally accessible within a few years31:21
Activehigh confidence ScienceHealthTechnology

Remote telesurgery will become globally accessible within a few years

Since May 2026

The speaker predicts that due to ultra-low latency (0.2 ms), remote surgery will become widely available, allowing the world's best surgeons to operate on patients anywhere. This will eliminate the disparity in access to top medical care between rich and poor.

“That means that you can have the world's best surgeon operate on you no matter where you are. So, it's no longer about the rich only have access to the greatest doctors.” [31:21]
telemedicineremote surgerylatencyglobal healthcareAI
Future Forecasting Group·made 5/17/2026 Source
Major explosion in a metropolitan area0:12
Activelow confidence MilitaryDisastersPolitics

Major explosion in a metropolitan area

Since May 2026· New York City (or similar dense urban area)

A large explosion event will occur in a dense urban area such as New York City, resulting in a mushroom cloud, thick smoke, demolished structures, and a smoldering wasteland. The event is described as man-made, resembling a bombing or strike launched from a distance, with strategic conflict and war crime implications. It may involve missiles being launched back and forth. The prediction is part of a depopulation program aimed at reducing population for sustainability reasons.

“a very large impact uh explosion event happening there” [0:12]
explosionmetropolitanwarbombingdepopulation
Future Forecasters·made 5/17/2026 Source
Strategic conflict involving missile exchanges0:46
Activelow confidence MilitaryPolitics

Strategic conflict involving missile exchanges

Since May 2026

A strategic conflict will occur involving missiles launched back and forth between two locations, with a 'war never ends' phrase. The conflict is premeditated and has a war games feel, potentially escalating to a doomsday scenario.

“crossfire like missiles being launched back and forth from two different locations uh it felt like strategic conflict like a back and forth” [0:46]
missilesconflictwardoomsday
Future Forecasters·made 5/17/2026 Source
Depopulation event as crowd control4:10
Activelow confidence PoliticsEnvironment

Depopulation event as crowd control

Since May 2026

A planned event to reduce population in the name of sustainability, described as 'thinning the herd' or 'bringing the numbers down'. This may involve a large explosion or other disaster to control population due to lack of space and resources.

“a depopulation or a wipeout or crowd control thinning the herd bringing the numbers down and why felt like sustainability resources no space no food” [4:10]
depopulationsustainabilitycrowd controlresources
Future Forecasters·made 5/17/2026 Source
Blast wave destruction similar to Hiroshima5:19
Activelow confidence MilitaryDisasters

Blast wave destruction similar to Hiroshima

Since May 2026· Dense urban city (unspecified)

A powerful blast wave from an epicenter flattens a dense urban city, similar to Hiroshima. This is associated with war or war crime and may be part of the same explosion event above.

“this is like Hiroshima or you know it's that kind of visual here like the epicenter a blast wave it just flattens things” [5:19]
blastHiroshimaflattenwar crime
Future Forecasters·made 5/17/2026 Source
Fiat currency end within a century6:54
Activemedium confidence FinanceNews

Fiat currency end within a century

Since May 2026

The speaker asserts that fiat currency has had a good run for about a century but is about to come to an end. This implies a near-term collapse or replacement of fiat currency systems globally, likely within the next few decades. The reasoning is tied to the evolution of money toward distributed ledger technology and eventual interstellar commerce.

“fiat currency, which has had a pretty good run for about a century, and that's about to come to an end.” [6:54]
fiat currencyendcollapsefinance
Future Forecasting Group·made 5/16/2026 Source
Blockchain introduced as evolutionary step for ET contact6:37
Activelow confidence TechnologyCrypto

Blockchain introduced as evolutionary step for ET contact

Since May 2026

The speaker claims blockchain technology predates human civilization and was introduced to humanity at a specific stage of development to prepare for open association with extraterrestrials. The statement suggests that blockchain is not a human invention but a technology parceled out to us, and it will facilitate commerce with ET. This implies that distributed ledger technology will become the basis for interstellar trade.

“Blockchain is an evolutionary step to bring us up into open association with ET.” [6:37]
blockchainETevolutionary stepcommerce
Future Forecasting Group·made 5/16/2026 Source
Quantum entanglement ledgers enable instant interstellar consensus5:47
Activelow confidence TechnologyScienceSpace

Quantum entanglement ledgers enable instant interstellar consensus

Since May 2026

The speaker speculates that extraterrestrials may use a quantum form of hash graph based on entanglement-based ledgers, allowing instant consensus across star systems via quantum entanglement. This prediction posits a future technology that would revolutionize interstellar commerce and communication, potentially being used by advanced civilizations.

“They may use a quantum form of hash graph that uses entanglement based ledgers... instant consensus across star systems.” [5:47]
quantum entanglementledgerhash graphinterstellar
Future Forecasting Group·made 5/16/2026 Source
Human consciousness as a commodity for ETs7:47
Activelow confidence ScienceWoowoo

Human consciousness as a commodity for ETs

Since May 2026

The speaker suggests that if ETs have unlimited energy and matter manipulation, the only thing of value would be unique conscious states. Human souls or novel conscious experiences may become a fungible commodity for extraterrestrials. This is presented as a speculative possibility about the nature of future human-ET interaction.

“It may be that human beings on this Earth have novel conscious states... in essence becomes a commodity.” [7:47]
human consciousnesscommodityETsoul
Future Forecasting Group·made 5/16/2026 Source
ET disclosure underway as soft rollout0:19
Activemedium confidence NewsPolitics

ET disclosure underway as soft rollout

May 2026 - Open

The speaker states that extraterrestrial disclosure is already underway in the form of a soft rollout, implying that governments or institutions are gradually admitting the existence of ETs. This prediction suggests that full disclosure will occur soon, altering public knowledge and global affairs.

“ET disclosure is underway. It's kind of a soft rollout.” [0:19]
ET disclosuresoft rolloutgovernmentextraterrestrial
Future Forecasting Group·made 5/16/2026 Source
Stars as portals to another dimension2:09
Activelow confidence ScienceSpaceParanormal

Stars as portals to another dimension

Since May 2026

The speaker recounts a remote viewing impression that stars are not fusion balls but portals to another dimension, which could be used as an energy form. This speculative claim about the nature of stars implies a paradigm shift in physics and energy generation.

“Stars are portals to another dimension.” [2:09]
starsportalsdimensionenergy
Future Forecasting Group·made 5/16/2026 Source
Gold not used by ETs due to transmutation and asteroid mining4:31
Activemedium confidence ScienceSpace

Gold not used by ETs due to transmutation and asteroid mining

Since May 2026

The speaker argues that gold is not used as money by ETs because they can transmute elements and mine asteroids, making gold abundant and valueless for interstellar trade. This challenges the ancient astronaut theory that ETs needed gold from Earth.

“ETs aren't using gold as money because they can transmute elements, because they can mine asteroids.” [4:31]
goldETtransmutationasteroid mining
Future Forecasting Group·made 5/16/2026 Source
Quantum computing breaks blockchain cryptography5:21
Activemedium confidence TechnologyCrypto

Quantum computing breaks blockchain cryptography

Since May 2026

The speaker predicts that ETs' quantum computing abilities will break the cryptology underlying blockchain, particularly proof-of-work systems like Bitcoin. This implies that current cryptocurrencies will become obsolete in the face of advanced quantum computation, affecting future financial systems.

“Quantum computing breaks the cryptology.” [5:21]
quantum computingblockchaincryptographyBitcoin
Future Forecasting Group·made 5/16/2026 Source
Trump UFO disclosure files were a distraction from war3:42
Activemedium confidence PoliticsMilitary

Trump UFO disclosure files were a distraction from war

Since May 2026

According to psychic channeling of Donald Trump, the release of UFO files by the Trump administration in May 2026 was intended as a smoke screen to distract the public from ongoing war and to remove scrutiny from Trump himself. The prediction asserts that the motivation behind the disclosure was not genuine transparency but political theater.

“To distract people. To give them instead of focusing on the war, it was to remove scrutiny upon himself.” [3:42]
TrumpUFO disclosuredistractionwarpolitical theater
Psychic Liz Cross·made 5/16/2026 Source
No grand public alien contact disclosure planned7:21
Activemedium confidence PoliticsScience

No grand public alien contact disclosure planned

Since May 2026

The channeled Trump indicates that there are no plans for a major public disclosure event like in 'Close Encounters of the Third Kind'. Governments do not have the capability or contact level to arrange such an event, as the phenomena remain poorly understood.

“I think when people are believing in disclosure, they're thinking we've got contact with aliens, we're going to have a designated meeting point... Not happening.” [7:21]
disclosurealien contactgovernmentcapabilities
Psychic Liz Cross·made 5/16/2026 Source
UFOs are energy beings that can manifest physically8:55
Activelow confidence ScienceParanormal

UFOs are energy beings that can manifest physically

Since May 2026

The channeled craft reveals that UAPs are solid but can transform into energy. Their occupants are primarily energetic beings who can take physical form when needed, especially in Earth's atmosphere which is more compatible with physical existence. The craft are internally controlled.

“It can transform itself into energy.” [8:55]
UAPenergy beingsphysical manifestationcraftearth atmosphere
Psychic Liz Cross·made 5/16/2026 Source
UFOs appear to toy with military and are multiple species11:57
Activelow confidence MilitaryScience

UFOs appear to toy with military and are multiple species

Since May 2026

The channeled source states that UAPs intentionally appear to military personnel to be seen, not for a serious purpose but merely to toy with humans. Crafts originate from many different places, not just one race or species.

“Just to sort of toy with the military, toy with us. Just playing around because they can.” [11:57]
UFOmilitarytoyingmultiple speciesintentional sightings
Psychic Liz Cross·made 5/16/2026 Source
Cardano ADA price spike within 3 months0:57
Activemedium confidence CryptoFinance

Cardano ADA price spike within 3 months

May 2026 - Aug 2026

Based on remote viewing sessions, there will be a significant spike in Cardano's price within a 3-month period from the session date (May 2026), driven by hype and market activity. The spike is described as a build-up and rise, with people riding the wave. However, this is followed by a downturn, and the overall long-term outlook is not extremely bullish, with no 50x or 100x gains predicted.

“I got the sense of like a big spike, like a build-up and a rise, a lot of hype.” [0:57]
CardanoADAprice spikehyperemote viewing
Future Forecasters·made 5/16/2026 Source
Cardano ADA uptrend over 6 months1:49
Activemedium confidence CryptoFinance

Cardano ADA uptrend over 6 months

May 2026 - Nov 2026

Over a six-month period from the session date, Cardano's price is predicted to experience an overall uptrend. The remote viewer sensed a positive movement upward, with an intense positive phase. This suggests continued growth in the medium term, but with volatility and eventual slowing.

“In the six-month period, it felt like an uptrend over.” [1:49]
CardanoADAuptrendsix monthspositive
Future Forecasters·made 5/16/2026 Source
Cardano ADA big drop then steady rise over 1 year2:13
Activemedium confidence CryptoFinance

Cardano ADA big drop then steady rise over 1 year

May 2026 - May 2027

Over a one-year period from the session date, Cardano's price is predicted to experience a significant drop within a few months, followed by a steady upward trend. The initial drop is part of a volatile phase, but the overall trajectory recovers and rises.

“I see a big drop in a few months and then steadily upward.” [2:13]
CardanoADAdroprecoverysteady rise
Future Forecasters·made 5/16/2026 Source
Cardano ADA microtransaction flood within 2 years3:30
Activemedium confidence CryptoTechnology

Cardano ADA microtransaction flood within 2 years

May 2026 - May 2028

Within two years from the session date, Cardano will experience a massive increase in transaction volume, described as millions of microtransactions raining down. This suggests widespread adoption for payments and high network activity, potentially driving value.

“I then tried to chart this out for 2 years and ... transactions, payments, thousands upon thousands of transactions continuously.” [3:30]
CardanoADAmicrotransactionsadoptionnetwork activity
Future Forecasters·made 5/16/2026 Source
Cardano ADA overall moderate performance no moon shot10:20
Activehigh confidence CryptoFinance

Cardano ADA overall moderate performance no moon shot

May 2026 - Open

Over the next two years, Cardano's performance will be moderate but not explosive. Remote viewers agree there is no 50x or 100x moon shot. The price will move upward enough to make some money, but expectations should be tempered.

“I didn't see the big chart and I think Edward is going along with that ... we don't none of us got like 100x 50x.” [10:20]
CardanoADAmoderateno moonshotperformance
Future Forecasters·made 5/16/2026 Source
Cardano ADA planned obsolescence or limited viability1:52
Activelow confidence CryptoTechnology

Cardano ADA planned obsolescence or limited viability

Since May 2026

Remote viewing data suggests a concept of planned obsolescence around Cardano, indicating that something about the project is made to eventually fail or has a limited lifespan. This could refer to a specific component, partnership, or the project's long-term sustainability, but not necessarily the entire project.

“And then I got the idea of planned obsolescence. Like something that's made to fail. It's made to eventually fail. It's only a limited time or it expires.” [1:52]
Cardanoplanned obsolescencelimited timefail
Future Forecasters·made 5/16/2026 Source
Cardano ADA stays in top 10 long term8:20
Activemedium confidence CryptoFinance

Cardano ADA stays in top 10 long term

Since May 2026

Cardano will remain among the top 10 cryptocurrencies by market cap for a long time to come, indicating sustained relevance despite potential price fluctuations.

“Cardano's been around for a while, and it'll probably stay in the top 10 for a long time to come.” [8:20]
Cardanotop 10long termmarket cap
Future Forecasters·made 5/16/2026 Source
Human DNA manipulation and superhuman creation0:43
Activelow confidence ScienceTechnology

Human DNA manipulation and superhuman creation

Since May 2026

The remote viewer describes a future or parallel scenario where humans are being subjected to genetic modification, implants, and biohacking to achieve a heightened state of mind, becoming superhuman or genius. The process is likened to a lobotomy and upgrade, with a sense of manifest destiny. The beings performing this are possibly non-human, and the viewer senses a need for help. This suggests a controversial technological advancement in genetic engineering aimed at human enhancement, possibly involving extraterrestrial or transdimensional entities. The prediction implies ethical and societal consequences, such as corruption of the gene pool and a transgression against nature.

“Becoming something new they're test subjects for some kind of integration or assimilation. It's the value proposition is like height a heightened state of mind almost like becoming a superhuman or like a genius once you get this done to you they're like lobotomized and upgraded” [0:43]
DNA manipulationbiohackingsuperhumangenetic engineeringimplants
Future Forecasters·made 5/16/2026 Source
Separation of Earth humans from non-human entities4:24
Activelow confidence PoliticsWoowoo

Separation of Earth humans from non-human entities

Since May 2026

The prediction states that people of Earth will separate from people not of Earth, implying a future event where humanity divides from extraterrestrial or transdimensional beings. A pact or agreement is made that relieves tension and disappointment on both sides. The unwilling will be separated, leading to calm. This suggests a future resolution of contact between humans and non-human intelligence, possibly through a formal treaty or separation, with consequences for global society.

“The notion is that people of Earth separate from people not of Earth. Some type of pact is made or figured out and it's a good thing. This helps to relieve the tension and disappointment from both sides” [4:24]
alien contactseparationpactnon-humanEarth
Future Forecasters·made 5/16/2026 Source
Teleportation via DNA quantum entanglement7:08
Activelow confidence ScienceTechnology

Teleportation via DNA quantum entanglement

Since May 2026

The remote viewer describes a concept of teleportation where an exact replica of a person's DNA is transmitted via quantum entanglement, and the soul attaches to the new body. The person experiences a brief near-death experience and reappears instantly in a new place. This suggests a future technology for instantaneous travel, potentially involving advanced physics and consciousness. The prediction is highly speculative but outlines a mechanism for teleportation that could revolutionize transportation.

“if you make an exact replica of the DNA and transit it via quantum entanglement, the soul will attach to it. The person who is teleported has a near-death experience briefly and comes back instantly in a new place.” [7:08]
teleportationquantum entanglementDNA replicationsoultransport
Future Forecasters·made 5/16/2026 Source
An energy discharge event interpreted as an omen of destruction9:30
Activelow confidence ParanormalDisastersMilitary

An energy discharge event interpreted as an omen of destruction

Since May 2026

The viewer describes a scenario where an energy discharge is intentionally created or summoned, with a snake-like aura, striking without warning. Bystanders witness it, leading to a need for cover-up or sterilization due to shock and awe. The event is interpreted as a warning sign or foreshadowing of future destruction. This likely refers to a paranormal or technological event that causes fear and apprehension, possibly a weapon or anomalous phenomenon that poses a threat to life on Earth.

“There is an energy discharge that is received. This is intentionally created or summoned. It is greeted with ecstasy. They bathe in it. It has a snake-like feel or aura... Event is interpreted as a warning sign, an omen, or a foreshadowing of future destruction.” [9:30]
energy dischargeomendestructionwarningparanormal event
Future Forecasters·made 5/16/2026 Source
Commodity supply crunch and price increase18:54
Activemedium confidence FinanceEnergy

Commodity supply crunch and price increase

May 2026 - Open

Henry McFee predicts a near-term supply crunch for copper, silver, and gold due to long lead times in mining (12-15 years from discovery to production) and rising demand from industrial uses (electric cars, solar panels) and central bank buying. This supply-demand imbalance will drive up prices of these metals.

“We're going to see a lot of, you know, supply crunch and and a lot of supply need need sort of coming from the from the market for copper, for silver, for gold. And I think that's what's going to lead to a lot of, you know, price increase in these in these assets.” [18:54]
supply crunchcoppersilvergoldprice increasemining
Future Forecasting Group·made 5/16/2026 Source
US recession and market crash in 20261:40
Activemedium confidence FinanceMilitary

US recession and market crash in 2026

Jun 2026 - Dec 2026· United States

Ed Dowd predicts a significant economic crash in 2026, affecting both the stock market and the housing market. He believes the stock market is overvalued and that housing prices must fall. The crash is expected to occur by late 2026, around October or November. Interest rates are forecast to rise again. Gold and silver are expected to see modest gains of 5-10%.

“He thinks going into a deeper recession by October, September, October, November.” [1:40]
recessioncrashstock markethousinginterest ratesgold
Psychic Liz Cross·made 5/15/2026 Source
Gold and silver prices rise moderately3:50
Activemedium confidence Finance

Gold and silver prices rise moderately

Jun 2026 - Feb 2027

Ed Dowd predicts that gold and silver prices will rise by 5-10% over the coming months. This is due to the economic downturn but constrained by lack of disposable income among consumers.

“5 to 10%. Not by much. He doesn't believe there's enough disposable income out there.” [3:50]
goldsilverpricesincreasedisposable income
Psychic Liz Cross·made 5/15/2026 Source
Housing market crash and stock market decline6:08
Activemedium confidence Finance

Housing market crash and stock market decline

Jun 2026 - Dec 2026· United States

Dave Collum predicts a housing market crash and stock market decline in the US. Housing prices will drop, and the stock market will fall. Gold and silver will rise slightly. The bond market will hold steady.

“He believes gold is going up. Housing's going down, stock market going down, bond market is holding steady.” [6:08]
housing crashstock declinegoldsilverbonds
Psychic Liz Cross·made 5/15/2026 Source
Gold and silver surge over 10% by early 202710:42
Activemedium confidence Finance

Gold and silver surge over 10% by early 2027

May 2026 - Feb 2027

Looking back from February 2027, gold and silver prices are seen to have gone 'through the roof' with increases of 10-15% since May 2026.

“Gold's gone up by what? 10 to 15. And then what about silver? About the same.” [10:42]
goldsilversurgeincrease10-15%
Psychic Liz Cross·made 5/15/2026 Source
Housing market stagnates with price declines11:35
Activemedium confidence Finance

Housing market stagnates with price declines

Jun 2026 - Feb 2027· United States

Dave Collum, looking back to February 2027, reports that the housing market has gone down and is not moving much. Condos and apartments are particularly hard hit due to HOA fees, with fewer sales.

“The housing market has gone down. Is it moving much? No, not really. Things are not selling very much.” [11:35]
housingdeclinestagnationcondosHOA
Psychic Liz Cross·made 5/15/2026 Source
Nasdaq and AI tech stocks decline12:55
Activemedium confidence TechnologyFinance

Nasdaq and AI tech stocks decline

Jun 2026 - Feb 2027· United States

Dave Collum sees the Nasdaq and AI tech stocks declining by February 2027, indicating a 'tech bust' or correction.

“AI tech stock bust? Overall, yes, it's gone down.” [12:55]
NasdaqAItech bustdecline
Psychic Liz Cross·made 5/15/2026 Source
Bitcoin price decline to around $50k13:20
Activemedium confidence FinanceCrypto

Bitcoin price decline to around $50k

Jun 2026 - Feb 2027

By February 2027, Bitcoin has fallen to a low of around $50,000 to $59,000, after briefly reaching near $85,000-$90,000 around the midterms before crashing.

“Bitcoin, has it gone down dramatically since May 2026? I mean, yeah, I'm getting like prices in the 50s.” [13:20]
Bitcoinpricedecline$50k
Psychic Liz Cross·made 5/15/2026 Source
Tariffs backfire and cause economic disaster16:03
Activemedium confidence PoliticsFinance

Tariffs backfire and cause economic disaster

Jan 2026 - Feb 2027· United States

Both economists agree that the tariffs implemented under Trump are a total disaster, backfiring and causing economic harm without achieving intended goals.

“No, the tariff thing was a disaster. Total disaster, complete disaster... backfired big time.” [16:03]
tariffsdisastereconomybackfire
Psychic Liz Cross·made 5/15/2026 Source
Food prices remain high despite oil drop16:33
Activemedium confidence FinanceEnvironment

Food prices remain high despite oil drop

Jun 2026 - Feb 2027· United States

Despite a drop in oil prices, retail food prices have not come down; they remain elevated.

“What's happened to? It has come down, but retail has not. Food prices, they have not. Prices are not coming down at all.” [16:33]
food pricesinflationretailsticky
Psychic Liz Cross·made 5/15/2026 Source
Western decline and rise of Russia as dominant power21:54
Activelow confidence PoliticsMilitary

Western decline and rise of Russia as dominant power

Jan 2026 - Open

Liz Cross predicts the West is in a gradual, inevitable decline. Russia will become a dominant global force, while China's business competitiveness may suffer due to its AI job protection policies, leading businesses to leave China.

“The West is going into a gradual decline. And it's not anything that they can salvage themselves from... Russia becoming a dominant force.” [21:54]
WestdeclineRussiadominancegeopolitics
Psychic Liz Cross·made 5/15/2026 Source
Secret Society and Political Maneuvering in the US2:00
Activelow confidence PoliticsMilitary

Secret Society and Political Maneuvering in the US

Since May 2026· United States

The remote viewer describes a strategic plan involving covert discussions and back channels with an American flavor, resembling a political secret society like Skull and Bones. This plan involves a person on the rise maneuvering into position by any means necessary, and there are two other male lives with global impact plans, one over 50 and highly placed. The prediction suggests that there is a hidden agenda or alliance being formed that will affect the future.

“Lots of covert discussions and back channels. Very kind of sneaky feel to this. Almost like a dark feel to it. Very like AOL's here a political secret society feel. Very kind of skull and bones feel.” [2:00]
covertsecret societySkull and Bonespolitical maneuveringalliance
Future Forecasters·made 5/15/2026 Source
UFO Files Release Sooner Than Expected7:07
Activelow confidence NewsSciencePolitics

UFO Files Release Sooner Than Expected

Since May 2026

A remote viewer suggests that news about UFO files being released will come out sooner than anticipated, possibly connected to the Trump-Xi summit context. This prediction implies an acceleration of government transparency regarding unidentified aerial phenomena, potentially influencing international relations or public discourse. The viewer notes this as a personal overtaking, indicating the timing may be imminent or surprising.

“with the news about UFO files being released sooner and I might have overtaken a little bit.” [7:07]
UFOfilesreleasesoonertransparency
Future Forecasters·made 5/15/2026 Source
US Military Involvement in Venezuela and Taiwan12:14
Activelow confidence PoliticsMilitaryEnergy

US Military Involvement in Venezuela and Taiwan

Since May 2026· Venezuela, Taiwan

The host speculates that the US has taken over Venezuela to some extent and that China has its sights set on Taiwan. He proposes that a possible behind-the-scenes deal at the summit could involve Trump asking Xi to back off Taiwan in exchange for releasing Venezuelan oil needed by China. This indicates ongoing geopolitical tensions and potential negotiations over Taiwan's status and Venezuelan resources.

“Trump maybe Trump's like, I have an idea, you back off of Taiwan and we'll maybe release some of that much-needed Venezuelan oil that all y'all need so preciously.” [12:14]
TaiwanVenezuelaoildealTrumpXi
Future Forecasters·made 5/15/2026 Source
Banks mandated to report crypto transactions3:06
Activehigh confidence FinanceTechnologyPolitics

Banks mandated to report crypto transactions

Since May 2026

The video predicts that all banks will be required to report any wire transfers in and out of cryptocurrency platforms to tax authorities, such as the IRS. This is part of a broader regulatory clampdown where the government actively seeks out crypto businesses worldwide that are not issuing 1099 forms, even if they are based outside the U.S., imposing fines on non-compliant foreign companies. This increases transparency and tax enforcement in the crypto space.

“all of the banks are going to be reporting any wires in and out of cryptocurrency platforms” [3:06]
banksreportingcryptotaxIRS1099
Future Forecasting Group·made 5/15/2026 Source
Canton Network tokenization of stocks and securities7:05
Activemedium confidence FinanceTechnology

Canton Network tokenization of stocks and securities

Since May 2026

The speaker claims that the Canton Network, a token with a price of 15 cents, is being pioneered by the Depository Trust & Clearing Corporation (DTCC), which holds $100 trillion in assets. This network will tokenize stocks and securities, moving them online to operate 24/7, 365 days a year, effectively replacing traditional stock exchanges like the NYSE and Charles Schwab. The prediction implies a shift to blockchain-based trading of traditional financial assets.

“Canton's a very cool project. It's for tokenizing stocks, securities. So, they're going to go online instead of the New York Stock Exchange, Charles Schwab. 24/7, 365, no break.” [7:05]
Canton NetworktokenizationstockssecuritiesDTCCblockchain
Future Forecasting Group·made 5/15/2026 Source
Clarity Act to boost crypto prices upon passage29:00
Activemedium confidence FinancePoliticsTechnology

Clarity Act to boost crypto prices upon passage

Since May 2026· United States

The video predicts that the passage of the Clarity Act in the U.S. will cause an immediate uptick in crypto prices, including Bitcoin and ISO 20022 utility coins. The expectation is that the regulation will allow American citizens to earn yield on stablecoins and use them as alternatives to fiat, encouraging more market participation and institutional FOMO (fear of missing out). The prediction notes that price increases may start before the actual passage due to speculation.

“It'll definitely be an immediate uptick, I'd say. Significant institutional FOMO is going to go preserve because it's legal now and they speaking the same language.” [29:00]
Clarity Actcryptoprice increaseinstitutionalstablecoin
Future Forecasting Group·made 5/15/2026 Source
Geopolitical uncertainty causing sell pressure on crypto36:40
Activehigh confidence FinancePoliticsDisasters

Geopolitical uncertainty causing sell pressure on crypto

Since May 2026

The speaker predicts that ongoing geopolitical uncertainty, including wars and inflation, will lead to sustained sell pressure on risky assets like Bitcoin, Ethereum, and Cardano. In times of uncertainty, people liquidate easily accessible liquid assets rather than selling homes or touching retirement accounts. Crypto will remain under pressure until risks subside and interest rates drop, at which point money will flow back into riskier assets.

“The reality is there's going to be a lot of sell pressure on Bitcoin and Ethereum and Cardano and the like. Because in times of uncertainty, people sell that.” [36:40]
geopoliticalsell pressureBitcoinEthereumriskuncertainty
Future Forecasting Group·made 5/15/2026 Source
Keir Starmer plans to destroy Labour Party from within10:18
Activemedium confidence Politics

Keir Starmer plans to destroy Labour Party from within

Since May 2026· UK

The probe suggests Keir Starmer, feeling betrayed and used, has adopted a scorched earth policy. If he cannot remain leader, he intends to implode the Labour Party by leaking damaging information to the press and refusing to resign, forcing internal struggles. This could lead to political instability in the UK government and affect upcoming elections.

“If he can't be the leader of the Labour Party, he wants it to implode from within and destroy itself.” [10:18]
StarmerLabour Partyimplosionscorched earthUK politics
Psychic Liz Cross·made 5/15/2026 Source
Wes Streeting likely next Prime Minister if Starmer removed10:43
Activemedium confidence Politics

Wes Streeting likely next Prime Minister if Starmer removed

Since May 2026· UK

According to the probe, Keir Starmer views Wes Streeting as a capable Prime Minister, preferring him over Angela Rayner. The prediction is that Streeting, a Blairite, is confident he has already won the leadership race and believes he can restore public confidence in Labour. This suggests a potential shift in UK leadership if Starmer is ousted.

“Yes, he would. He hates Angela Rayner. ... He does think that he would make a good Prime Minister.” [10:43]
StreetingPrime MinisterLabour leadershipUK
Psychic Liz Cross·made 5/15/2026 Source
Reform UK to win next general election13:00
Activemedium confidence Politics

Reform UK to win next general election

Since May 2026· UK

The hosts and probe indicate that the majority of voters will support Reform UK in the next general election, based on current trends and the unpopularity of Labour and Conservatives. This prediction suggests a major political shift in the UK, with Reform UK potentially forming the next government.

“The next election, everybody or certainly the majority are voting reform.” [13:00]
Reform UKgeneral electionpolitical shiftUK
Psychic Liz Cross·made 5/15/2026 Source
UK society at risk of breakdown in summer 202620:40
Activelow confidence PoliticsDisasters

UK society at risk of breakdown in summer 2026

Jun 2026 - Aug 2026· UK

Mr. Shakespeare suggests that while society has not completely broken down, conditions could deteriorate to a critical point during the summer of 2026. This is based on existing hatred towards Starmer's policies and potential civil unrest, particularly in large cities.

“It could easily get there in the summer. I could see how that could happen um in the summer.” [20:40]
societal breakdownunrestsummer 2026UK
Psychic Liz Cross·made 5/15/2026 Source
UK to rejoin EU under Starmer's influence23:00
Activelow confidence Politics

UK to rejoin EU under Starmer's influence

Since May 2026· UK

The probe claims Keir Starmer is being paid to get the UK back into the EU, and even if he is removed as Prime Minister, he will continue to advise future leaders to pursue EU reentry. This prediction suggests that regardless of who leads Labour, the goal of rejoining the EU remains active.

“He will advise whoever takes over that this is what we're doing. We must rejoin the EU.” [23:00]
EU rejoinStarmerUKglobalist
Psychic Liz Cross·made 5/15/2026 Source
Remote Viewing of World Trade Center Pre-9/1110:30
Activelow confidence ParanormalWoowoo

Remote Viewing of World Trade Center Pre-9/11

Since May 2026

Edward Riordan performs a remote viewing session targeting the World Trade Center towers at a time frame before September 11, 2001. He describes receiving dimensional sensations of a tall, man-made structure with vertical lines, eventually identifying it as the World Trade Center tower. The prediction implies that the remote viewing technique can accurately perceive past events or structures, specifically the World Trade Center before the 9/11 attacks. No future outcome is predicted; rather, the session serves as a demonstration of remote viewing ability.

“It's starting to really look familiar to me, like the World Trade Center Tower.” [10:30]
remote viewingWorld Trade Centerpre-9/11dimensional sensationspsychic
Edward Riordan·made 5/15/2026 Source
Crypto has one or two good bull cycles left4:32
Activelow confidence FinanceCrypto

Crypto has one or two good bull cycles left

Since May 2026

In the conversation about cryptocurrency investing, Jordan states that there may be only one or two good bull cycles remaining in crypto specifically. This implies that the window for high returns in the crypto market is limited, and that as more people enter the space, the best opportunities will diminish, similar to how the stock market has fewer high-growth stocks over time.

“We might have one or two good bull cycles left in crypto specifically.” [4:32]
cryptobull cyclemarket opportunitydiminishing returns
Future Forecasting Group·made 5/15/2026 Source
AI agents will become standard within a few years41:01
Activemedium confidence TechnologyScience

AI agents will become standard within a few years

Since May 2026

Jordan predicts that within a few years, AI agents like Open Claw and Hermes will become standard tools that everyone uses. He argues that the current experimental phase will transition into widespread adoption, where individuals will have their own AI agents to manage tasks, and the technical headaches of today will be resolved.

“eventually within a few years this is all going to be standard. We're all going to be doing it. We're all going to have our own AI agents.” [41:01]
AI agentsopen clawhermesstandardizationadoption
Future Forecasting Group·made 5/15/2026 Source
AI will replace many jobs, forcing humans to think or be left behind1:07:00
Activemedium confidence TechnologyScience

AI will replace many jobs, forcing humans to think or be left behind

Since May 2026

Jordan claims that AI will automate many jobs that currently exist, making it impossible to maintain the old worker-education system. As a result, people will be forced to start thinking creatively and use AI tools to survive, or they will be left behind. This is framed as a catalyst for human evolution, freeing people from the rat race.

“so much of the jobs that people can now do can be replaced by AI that they don't have positions to fill them into. So, people are going to inevitably start thinking or they're going to die.” [1:07:00]
AIjob replacementhuman evolutioncreativity
Future Forecasting Group·made 5/15/2026 Source
Energy-based currency as future financial system11:52
Activelow confidence FinanceEnergy

Energy-based currency as future financial system

Since May 2026

Jordan discusses a theoretical future currency based on energy units, where every transaction is measured in a standard energy unit. He contrasts this with an AI token-based currency and notes that such a system faces barriers. The prediction is speculative and not asserted with high certainty.

“the future currency is going to be energy-based.” [11:52]
energy currencyfuture financeenergy units
Future Forecasting Group·made 5/15/2026 Source
DeFi projects built on Bitcoin will fail long-term24:20
Activemedium confidence CryptoFinance

DeFi projects built on Bitcoin will fail long-term

Since May 2026

Jordan predicts that DeFi projects attempting to build on Bitcoin will not survive long term, because Bitcoin holders are psychologically unwilling to transact and lose satoshis, and because Bitcoin's security model requires Bitcoin for gas. He notes that such projects appear every cycle but never gain real adoption.

“I wonder if any of these projects that are really being built on Bitcoin are going to survive long term.” [24:20]
BitcoinDeFilong-term survivalpsychological barrier
Future Forecasting Group·made 5/15/2026 Source
Secret global operation involving governments, CIA, military, and drugs1:57
Activelow confidence PoliticsMilitaryHealth

Secret global operation involving governments, CIA, military, and drugs

Since May 2026

The remote viewer describes a highly secretive, multi-layered global operation connected to governments, the CIA, the military, and drug trafficking. The target is a large corporation with a male CEO over 40 in the US, associated with money, labs, and funds. The viewer senses inappropriate activities, possibly money laundering and asset flipping, on a massive scale with covert involvement of state actors. This is presented as an ongoing or impending revelation of corruption and manipulation at the highest levels.

“I felt like this was to do with governments, corporations, part military, drugs, and CIA.” [1:57]
CIAgovernmentsdrugsmoney launderingglobal conspiracyPfizer
Future Forecasters·made 5/14/2026 Source
Global financial shutdown and reset over a weekend5:12
Activemedium confidence FinanceTechnology

Global financial shutdown and reset over a weekend

Since May 2026

The remote viewers describe a scenario where the financial system is intentionally shut down, likely on a Friday, to allow for a reset over the weekend (Saturday and Sunday), referred to as 'three days of darkness'. This involves pulling the plug on exchanges, turning off TVs, and having comptrollers still working. After the shutdown, a tokenized system with blockchain-based smart contracts goes live, releasing trillions of dollars in liquidity. The transition is described as sudden and parabolic, catching unprepared investors off guard. The prediction is based on symbolic imagery of a dam holding back assets and a switch being flipped.

“It has that reset button signature. Like they shut down the exchange, pull the plug. And then turn it off.” [5:12]
financial resetthree days of darknessblockchaintokenizationliquidity
Future Forecasters·made 5/14/2026 Source
Cryptocurrency and blockchain integration accelerates6:59
Activemedium confidence FinanceTechnologyCrypto

Cryptocurrency and blockchain integration accelerates

Since May 2026

The prediction states that massive amounts of smart contracts are being designed, written, and tested, some by AI, to prepare financial instruments for a digital tokenized system. When the system comes online, the transition will be faster than most expect, and those not prepared will have no chance to invest. This suggests a rapid, parabolic shift in financial markets toward blockchain-based assets, potentially triggered by the shutdown described in the first prediction.

“In the background right now massive amounts of smart contracts are being designed, written, tested some by AI to have financial instruments ready to go digital. When the switch is hit, when it comes online they will be ready. It will be faster than most expect.” [6:59]
smart contractsAIdigital assetsblockchainparabolic
Future Forecasters·made 5/14/2026 Source
Global leaders convene for emergency crisis management0:02
Activelow confidence PoliticsMilitaryDisasters

Global leaders convene for emergency crisis management

Since May 2026

The remote viewer describes a motorcade and a stage with an audience, feeling like an official governmental event with a warning or foretelling of bad news. There is a desperate, panicked mood similar to lockdowns, with discussions of emergency measures, controls, and an uprising. The setting could involve a courtroom-like atmosphere with judges and jury, suggesting a debate or crisis management. This may relate to a global decision with immense impact, potentially involving war or nuclear action, but a 'no' response to nuclear action is indicated.

“Uh I see a motorcade moving. ... They're meeting with high-level people. Law enforcement would be at the scene ... It does have an official governmental feel. ... And it feels like a warning. ... desperate measures last straw mood to it.” [0:02]
motorcadeG7emergency measurescrisiswar
Future Forecasters·made 5/14/2026 Source
Remote viewing technique may become lost in modern society8:17
Activemedium confidence ScienceParanormal

Remote viewing technique may become lost in modern society

Since May 2026

James Vitale predicts that the remote viewing technique, a method of gaining intuitive information via bilocation and real-time documentation, could be lost in the shuffle due to the rise of social media and lack of institutional training. He notes that without external tools, the process of consciousness itself may be forgotten by future generations. This is based on his observation over 20 years that such abstract skills are not preserved in modern society.

“I can totally see how really crucial intuitive and abstract information like the remote viewing technique could get lost in the shuffle where people simply don't know it, they forget how to do it.” [8:17]
remote viewingconsciousnesslost knowledgeintuitive informationsociety
Psychic Recon - James Vitale·made 5/14/2026 Source
Mini-course will not teach remote viewing mastery0:50
Activehigh confidence ScienceParanormal

Mini-course will not teach remote viewing mastery

Since May 2026

Vitale states that his upcoming mini-course on remote viewing will almost certainly not teach viewers how to actually remote view. He explains that the course will provide basic structure and concepts, but developing significant skill or mastery requires more training. Only those who are incredibly intelligent and super talented might be able to learn. This is due to the counter-intuitive nature of remote viewing and the need to bypass the conscious mind.

“These will almost without a doubt not be able to teach you how to remote view.” [0:50]
remote viewingmini-coursetrainingmasterylearning
Psychic Recon - James Vitale·made 5/14/2026 Source
Digital dollar enables mass surveillance and control26:24
Activemedium confidence FinancePoliticsTechnologyNews

Digital dollar enables mass surveillance and control

Since May 2026

The introduction of a digital dollar (tokenization of currency) is portrayed as a tool for mind control and surveillance, eroding personal freedom. It will not erase debt as some claim, but will allow authorities to track all transactions and know everything about individuals. This prediction warns of a loss of privacy and autonomy.

“It looks like mind control. Now they've got you. Now they know everything about you. You are no longer free once the digital dollar comes in.” [26:24]
digital dollartokenizationsurveillancemind controlfreedom
Psychic Liz Cross·made 5/13/2026 Source
Kardashians tied to Illuminati and shadow government0:22
Activelow confidence ParanormalPolitics

Kardashians tied to Illuminati and shadow government

Since May 2026

Remote viewing of the Kardashian family reveals they are part of the Illuminati or shadow government. Their rise to fame was orchestrated by Kris Jenner, who desired power and came from a bloodline already involved in that world. Initiations involve contracts, body selling, ritual possession by reptilian entities, and sacrifices of close individuals. The prediction implies that being part of this dark world will lead to negative consequences, though no specific future event is described.

“They are absolutely a part of the Illuminati or the shadow government.” [0:22]
KardashiansIlluminatishadow governmentKris Jennerinitiation sacrifice
Elizabeth April·made 5/13/2026 Source
Kardashians engaged in ritualistic body selling0:51
Activelow confidence Paranormal

Kardashians engaged in ritualistic body selling

Since May 2026

The Kardashians' involvement in the Illuminati includes signing contracts that involve selling their bodies, which allows entities or reptilians to take over through rituals. This is part of their indoctrination into the entertainment industry. The prediction suggests a pattern of behavior rather than a specific future event, with low specificity.

“What happens when you sell your body is your body is either taken over by an entity, by a reptilian, usually through a lot of rituals.” [0:51]
body sellingreptilianritualsentity possession
Elizabeth April·made 5/13/2026 Source
Sacrifice initiation for Kardashian family1:53
Activelow confidence Paranormal

Sacrifice initiation for Kardashian family

Since May 2026

As part of their gang initiation into the shadow organization, a sacrifice occurs involving the death of someone close to the initiate. This is presented as a requirement for joining, though no specific incident or victim is named. The prediction is vague and lacks concrete details.

“The sacrifice happens when someone close to that person ends up dying.” [1:53]
sacrificeinitiationdeath
Elizabeth April·made 5/13/2026 Source
Negative consequences for Kardashians due to shadow ties2:44
Activelow confidence Paranormal

Negative consequences for Kardashians due to shadow ties

Since May 2026

The prediction asserts that 'nothing good can come of' being part of the shady Illuminati world, implying future negative repercussions for the Kardashian family. However, no specific events or timelines are given, making it an open-ended warning.

“Nothing good can come of that.” [2:44]
negative consequencesKardashians
Elizabeth April·made 5/13/2026 Source
HBAR average performance over 3 months2:47
Activemedium confidence Crypto

HBAR average performance over 3 months

May 2026 - Aug 2026

Liz predicts that HBAR will perform at an average level, rating 5 out of 10, over the next three months. The prediction is based on a remote viewing scale (1-10) and suggests no exceptional gains or losses in this period.

“How well does HBAR do next 3 months on a scale of 1 to 10? I'm getting it's average. It's five.” [2:47]
HBARcryptocurrencyperformance3 months
Psychic Liz Cross·made 5/13/2026 Source
HBAR has longevity for future cycle0:54
Activemedium confidence Crypto

HBAR has longevity for future cycle

Since May 2026

Liz indicates that HBAR has longevity, meaning it is one of the coins that will survive the bear market and be a good candidate for the next cycle. This is part of her strategy to identify altcoins with long-term potential.

“And is there any longevity with this coin? Oh, yeah, there is.” [0:54]
HBARlongevitybear marketcycle
Psychic Liz Cross·made 5/13/2026 Source
Zcash scores 7 out of 10 over 3 months3:58
Activemedium confidence Crypto

Zcash scores 7 out of 10 over 3 months

May 2026 - Aug 2026

Zcash is predicted to score a 7 out of 10 over the next three months, indicating a moderately positive performance. However, Liz notes that this could involve a significant price bump followed by a crash, suggesting volatility.

“Zcash, how well does it do over the next 3 months on a scale 1 to 10? That's scoring it... It's scoring about a seven.” [3:58]
Zcashperformance3 monthsvolatility
Psychic Liz Cross·made 5/13/2026 Source
Zcash won't reach all-time high in 3 months4:05
Activemedium confidence Crypto

Zcash won't reach all-time high in 3 months

May 2026 - Aug 2026

Despite a high score, Zcash is not expected to reach its all-time high of $700 within the next three months. The current price is around $546, and the prediction rules out a run to that level in that timeframe.

“Do we reach the all-time high of 700 in the next 3 months? No.” [4:05]
Zcashall-time highprice target3 months
Psychic Liz Cross·made 5/13/2026 Source
Zcash lacks overall longevity4:58
Activemedium confidence Crypto

Zcash lacks overall longevity

Since May 2026

Liz says Zcash does not have overall longevity, meaning it is not expected to survive long-term or be a good hold for future cycles. This contrasts with HBAR.

“Does it have longevity? Not overall, no.” [4:58]
Zcashlongevitylong-term
Psychic Liz Cross·made 5/13/2026 Source
Mog Coin scores 2 out of 10 over 3 months5:17
Activemedium confidence Crypto

Mog Coin scores 2 out of 10 over 3 months

May 2026 - Aug 2026

Mog Coin, a meme coin, is predicted to perform poorly over the next three months, scoring only 2 out of 10. This indicates a significant decline or lack of positive movement.

“How does that fare over the next... I'm getting like a two over the next 3 months.” [5:17]
Mog Coinmeme coinperformance3 months
Psychic Liz Cross·made 5/13/2026 Source
Pepe on Ethereum scores 9 over 3 months6:05
Activemedium confidence Crypto

Pepe on Ethereum scores 9 over 3 months

May 2026 - Aug 2026

Pepe coin, on Ethereum, is predicted to perform very well over the next three months, scoring 9 out of 10. This is a strong bullish signal for the meme coin.

“Pepe on Ethereum. How well does it do over the next 3 months on a scale of 1 to 10? ... A nine.” [6:05]
PepeEthereummeme coinperformance3 months
Psychic Liz Cross·made 5/13/2026 Source
Clarity Act will not pass in two days7:43
Activehigh confidence PoliticsCrypto

Clarity Act will not pass in two days

Since May 2026· United States

Liz predicts that the Clarity Act draft bill will not be passed in the upcoming markup session (two days from the video date). It will take longer and require reworking.

“Clarity Act is going to be passed in two days time? I don't see it being passed in two days time.” [7:43]
Clarity ActCongressregulationdelay
Psychic Liz Cross·made 5/13/2026 Source
Hyperliquid may rise to upper $40s or $508:54
Activemedium confidence Crypto

Hyperliquid may rise to upper $40s or $50

Since May 2026

Liz predicts that Hyperliquid will not reach $60, but may rise to the upper $40s or possibly $50 within the near future.

“Can it get up to 60? No. Okay. It may go to the upper 40s. Maybe 50.” [8:54]
Hyperliquidprice target50upside
Psychic Liz Cross·made 5/13/2026 Source
Mass Disclosure via Declassified Documents0:47
Activemedium confidence NewsPoliticsMilitary

Mass Disclosure via Declassified Documents

May 2026 - Open

The Galactic Federation is planning a soft disclosure approach where knowledge of extraterrestrial life will first be revealed through declassified government documents. This is intended to prepare the global population gradually, avoiding fear and panic. After knowledge is established, full contact will follow, which may occur first at individual levels (through dreams, realizations, etc.) and later as a mass experiential event. The prediction states that mass contact is still a couple of years away.

“they said with disclosure, it's uh the knowledge is going to come first which is going to be more so through government declassified documents. It's like a soft approach” [0:47]
disclosureextraterrestrialdeclassified documentsGalactic Federationgovernment
Elizabeth April·made 5/12/2026 Source
Mass Contact in a Couple of Years3:58
Activemedium confidence NewsScienceSpace

Mass Contact in a Couple of Years

May 2026 - May 2028

Full mass contact with extraterrestrials, described as a full experiential event, is predicted to occur in a couple of years from the time of the video (May 2026). This follows an initial phase where knowledge of extraterrestrial life is established through soft disclosure. The prediction suggests that contact will be a gradual process, with individual contact already happening, but mass contact is still some time away.

“mass contact um which is going to be a full experiential event and that seems like we're a couple years away from but once again we have to establish knowledge first” [3:58]
mass contactextraterrestrialexperiential eventdisclosureGalactic Federation
Elizabeth April·made 5/12/2026 Source
Shadow government targeting solution creators0:29
Activemedium confidence PoliticsScienceTechnology

Shadow government targeting solution creators

Since May 2026

The prediction asserts that a shadow government is systematically targeting and eliminating scientists and influential figures who are developing solutions that challenge established industries like big pharma and big energy. This is part of a broader plan to suppress 'new earth solutions'—innovations in free energy, quantum mechanics, agriculture, plastics, and medicine—that could disrupt the status quo. The shadow government is described as desperate, losing control, resources, and public attention, and thus is accelerating its efforts to eliminate those on the verge of releasing such solutions to the public.

“Essentially, the shadow government plan is to take out as many individuals who are creating solutions to essentially targeted uh examples being like big pharma. Uh it could be uh the big energy companies.” [0:29]
shadow governmentscientistssolutionsbig pharmafree energysuppression
Elizabeth April·made 5/11/2026 Source
Shadow government targeting threat individuals across industries8:38
Activelow confidence NewsPoliticsFinanceHealthEnergyEnvironment

Shadow government targeting threat individuals across industries

Jan 2026 - Open

The shadow government is actively targeting and eliminating individuals who are direct threats to major industries, including science, big pharma, big energy, big finance, lumber, and fertility. This goes beyond missing scientists; many others are disappearing through accidents, suicides, or mysterious circumstances. The goal is to suppress solutions that challenge the status quo.

“Anyone within these big institutions and organizations like big finance as well who are coming out with solutions to the old industries, who are pushing for a change, are all being directly targeted right now.” [8:38]
shadow governmenttargetingthreat eliminationbig pharmabig energywhistleblowers
Elizabeth April·made 5/11/2026 Source
Shadow government pushing one world order and using AI for misinformation20:30
Activelow confidence NewsPoliticsTechnology

Shadow government pushing one world order and using AI for misinformation

Jan 2026 - Open

The shadow government's primary initiative is to establish a one world order through fear, control, and depopulation. They are also changing algorithms and using AI to spread misinformation. However, they are internally divided on strategy, leading to chaos. The viewer notes that double agents exist on both sides.

“They're pushing forward the One World Order. That's what they really want, right? That's what the Shadow Government wants. They want complete and utter control, depopulation, fear all around.” [20:30]
one world ordershadow governmentAImisinformationdepopulationdouble agents
Elizabeth April·made 5/11/2026 Source
Global conflicts resume0:46
Activemedium confidence PoliticsMilitaryNews

Global conflicts resume

Since May 2026

The speaker states that current world conflicts are momentarily calm but will not last, implying a resurgence of global conflicts. This is framed as part of a larger shift into 'wilderness' for the world.

“world conflicts are momentarily calm, momentarily, but that will not last” [0:46]
conflictsworldwarcalm
Farsight·made 5/11/2026 Source
Millions tune into Farsight31:00
Activelow confidence NewsScience

Millions tune into Farsight

Jun 2026 - Aug 2026

The speaker predicts that millions of people will suddenly start tuning into Farsight, possibly as early as summer 2026, due to the upcoming disclosure events. This reflects a belief that mainstream interest in remote viewing content will surge.

“millions of people suddenly tuning into Farsight, like this summer, perhaps” [31:00]
Farsightviewerssummersurge
Farsight·made 5/11/2026 Source
Amnesia grid failing31:22
Activelow confidence ParanormalScience

Amnesia grid failing

Since May 2026

The speaker asserts that the 'amnesia grid'—a control mechanism that causes humans to forget their true nature—is failing. This is a key claim in the prison planet narrative, predicting that the control system is weakening.

“The amnesia grid is failing, but the control mechanisms remain powerful” [31:22]
amnesia gridcontrolfailingprison planet
Farsight·made 5/11/2026 Source
US Elections and Potential Disclosure Timing1:29:49
Activemedium confidence PoliticsNews

US Elections and Potential Disclosure Timing

May 2026 - Nov 2026· United States

The speaker claims that US elections are six months away from May 2026 (placing them in November 2026) and that the current administration needs a win badly, which increases the likelihood of a controlled disclosure event. The administration will try to minimize and possibly falsify information, but a significant announcement about extraterrestrials is expected soon, possibly around the Roswell anniversary in July 2026.

“Elections that could decide the fate of the current administration are just six months away.” [1:29:49]
electionsdisclosureadministrationUS2026
Farsight·made 5/11/2026 Source
Global Conflicts Temporary Calm Before Escalation1:25:54
Activemedium confidence PoliticsDisastersMilitary

Global Conflicts Temporary Calm Before Escalation

May 2026 - Open

The speaker asserts that current world conflicts are momentarily calm but will not last, and that global turmoil will continue until humanity sees its existence in a new light. This suggests an imminent resurgence of wars or geopolitical tensions, possibly tied to the disclosure process or other destabilizing events.

“As I speak these words, world conflicts are momentarily calm. Momentarily. But that will not last.” [1:25:54]
conflictsgeopoliticalescalationworld2026
Farsight·made 5/11/2026 Source
Mass Influx of New Viewers to Farsight This Summer2:00:00
Activemedium confidence NewsTechnology

Mass Influx of New Viewers to Farsight This Summer

Jun 2026 - Aug 2026

The speaker predicts that millions of people will suddenly tune into Farsight's content during the summer of 2026, driven by the disclosure events and Spielberg's movie. This will require Farsight to have short-form videos ready for new audiences who are not yet familiar with long-form content.

“Perhaps they're not going to sit down and go through two or three hours... when the millions tune in to Farsight perhaps as early as this summer.” [2:00:00]
Farsightviewerssummerdisclosureaudience
Farsight·made 5/11/2026 Source
Farsight's New AI-Driven Video Series: New Sphere1:50:00
Activehigh confidence TechnologyScience

Farsight's New AI-Driven Video Series: New Sphere

May 2026 - Open

Farsight is launching a new short-form video series called 'New Sphere' (spelled 'nu sphere') that uses AI to generate unbiased summaries of remote viewing sessions. The series will be released twice a week on Farsight Prime and a couple per month on YouTube. The AI reads transcripts and creates videos autonomously, aiming to provide objective truth without human bias.

“We expect to have two of these short form videos come out each week.” [1:50:00]
FarsightAIvideo seriesremote viewingNew Sphere
Farsight·made 5/11/2026 Source
US dollar collapse leads to civil unrest
Activemedium confidence FinancePoliticsMilitaryDisasters

US dollar collapse leads to civil unrest

Since May 2026· United States

The remote viewer predicts the end of the US dollar as a functioning currency, leading to widespread civil unrest in American cities. Scenes include bank runs with citizens demanding their money, banks closing, soldiers deployed but disorganized and overwhelmed, streets barricaded with disabled vehicles and garbage, fires, looting, curfews, and a general breakdown of order. The prediction implies a complete loss of confidence in the financial system, triggering chaos and potential societal collapse.

“I think what I'm keen on is what's going to happen in America when the dollar dies.” [0:00]
dollar collapsecivil unrestbank runsoldiers overruncurfewbarricades
Future Forecasters·made 5/10/2026 Source
Cryptocurrencies Will Put Many Banks Out of Business4:28
Activemedium confidence FinanceTechnology

Cryptocurrencies Will Put Many Banks Out of Business

Since May 2026

The speaker asserts that the banking system dislikes cryptocurrencies, and that cryptos will cause many banks to fail if they do not adopt crypto-friendly policies. This prediction implies a significant disruption in the traditional banking sector due to the rise of digital currencies.

“Cryptos are going to put a lot of banks out of business.” [4:28]
cryptocurrencybanksdisruptionbusiness failure
Future Forecasting Group·made 5/10/2026 Source
Major metropolitan area vaporized by explosion0:21
Activelow confidence MilitaryDisasters

Major metropolitan area vaporized by explosion

Since May 2026

A remote viewer predicts a large-scale explosive event will destroy a dense urban center, comparable to Hiroshima. The vision describes an impact or blast wave that flattens buildings, leaving a smoldering wasteland, and suggests it may be man-made (war, weapon exchange) but could also involve a cosmic disaster like an asteroid or super volcano occurring simultaneously with war. The exact city is not specified but resembles New York. The prediction implies catastrophic loss of life and infrastructure, possibly altering maps.

“I see what looks like the central point of an impact, like flash point. Buffering waves coming up from there.” [0:21]
explosionmetropolitanvaporizationwarHiroshima
Future Forecasters·made 5/9/2026 Source
Large-scale global protests0:18
Activemedium confidence PoliticsNews

Large-scale global protests

Since May 2026

A remote viewer predicted large protests involving people all over the world, which materialized as a 'Snow King's rally' with 8 million plus participants in different places around the world on April 28th. This prediction aligns with subsequent global protest events.

“large protest that's people all over and it's going to be different places” [0:18]
protestsglobalrallySnow King's
Future Forecasters·made 5/9/2026 Source
Blockade with backlog of ships0:39
Activemedium confidence NewsMilitary

Blockade with backlog of ships

Since May 2026

A remote viewer saw a backlog of ships unable to move due to a blockade, with efforts to get them moving and lots of talking threats. This suggests a maritime disruption event that may involve geopolitical tensions or logistical issues.

“backlog of ships that wasn't able to move... efforts to get it moving and lots of talking threats” [0:39]
blockadeshipsbacklogmaritime
Future Forecasters·made 5/9/2026 Source
UFO files release mentioning 1952 DC incident2:02
Activelow confidence ParanormalPolitics

UFO files release mentioning 1952 DC incident

Since May 2026· Washington DC

A remote viewer envisioned a newspaper with UFOs above a building in DC, and noted that Trump said new files would be released, which would discuss historical incidents including the 1952 event over Washington DC.

“Trump said okay on I believe this was 17... new files would be released... historical incidents included 1952 event over Washington DC” [2:02]
UFOfilesrelease1952Washington DC
Future Forecasters·made 5/9/2026 Source
Uptick in restaurant closures4:10
Activemedium confidence FinanceNews

Uptick in restaurant closures

Apr 2025 - Open· United States

A remote viewer predicted an uptick in restaurant closures, and subsequently many restaurant chains announced closures in the near future in the United States.

“uptick in restaurant closures and last month there was a lot of restaurants that announced mainly chains that they're closing a lot of restaurants in the near future here in the United States” [4:10]
restaurantclosureschainseconomy
Future Forecasters·made 5/9/2026 Source
Oil spills causing wildlife contamination5:05
Activemedium confidence EnvironmentDisasters

Oil spills causing wildlife contamination

Since May 2026· Black Sea, Gulf of Mexico

A remote viewer saw birds covered in oil, and two possible hits were identified: an oil spill in the Black Sea with tons of birds and animals covered in oil, and a Gulf of Mexico oil spill that killed wildlife and polluted Mexican waters.

“birds covered in oil... oil spill in the Black Sea... tons of birds and animals all covered in oil... Gulf of Mexico oil spill that killed wildlife” [5:05]
oil spillwildlifebirdspollution
Future Forecasters·made 5/9/2026 Source
Mass bird deaths from bird flu and other causes5:31
Activemedium confidence EnvironmentDisasters

Mass bird deaths from bird flu and other causes

Apr 2025 - Open· Indiana, California, Europe

A remote viewer predicted mass bird deaths, and possible hits included bird flu in Indiana, California coastal birds dying in large numbers (April 2nd), and a huge die-off of puffins along the European coast.

“mass bird deaths... bird flu in Indiana... California coastal birds are dying... huge die-off of the puffins along the coast of Europe” [5:31]
bird deathsbird flupuffinswildlife
Future Forecasters·made 5/9/2026 Source
Fake assassination story to garner sympathy6:40
Activelow confidence PoliticsNews

Fake assassination story to garner sympathy

Since May 2026

A remote viewer predicted a fake assassination story meant to garner sympathy or support, with a past-tense feel. Two options emerged: a planned fake assassination attempt on Orban to boost his poll numbers, and Jesse Ventura claiming the Trump assassination attempt was faked.

“fake assassination story... something meant to garner sympathy or support” [6:40]
assassinationfakeOrbanTrump
Future Forecasters·made 5/9/2026 Source
Large retail mass layoffs7:40
Activemedium confidence FinanceNews

Large retail mass layoffs

Since May 2026· United States

A remote viewer predicted large retail announcing mass layoffs, and several occurred: Oracle laid off a tremendous number of people, Amazon slashing 16,000, Dow cutting 4,500, and Mastercard layoffs.

“large retail announces mass layoffs... Oracle laid off a tremendous number of people. Amazon slashing 16,000. Dow cutting 4,500. Mastercard.” [7:40]
layoffsretailOracleAmazonDowMastercard
Future Forecasters·made 5/9/2026 Source
Shipping companies in distress with fuel surcharges8:01
Activemedium confidence FinanceNews

Shipping companies in distress with fuel surcharges

Since May 2026

A remote viewer predicted shipping companies in distress due to high fuel costs, and subsequently many companies announced fuel surcharges for deliveries, including the US Postal Service's first 8% fuel surcharge on packages.

“shipping companies in distress... high fuel costs... everybody now is announcing fuel surcharges for deliveries... Postal Service, first time doing an 8% fuel surcharge on packages.” [8:01]
shippingfuel surchargePostal Servicecosts
Future Forecasters·made 5/9/2026 Source
Bipartisan condemnation for military use abroad8:59
Activemedium confidence PoliticsMilitary

Bipartisan condemnation for military use abroad

Since May 2026· Iran

A remote viewer predicted bipartisan condemnation for military use abroad, and last month there was a lot of bipartisan pushback against Iran issues.

“bipartisan condemnation for military use abroad... a lot of bipartisan pushback against Iran” [8:59]
bipartisanmilitarycondemnationIran
Future Forecasters·made 5/9/2026 Source
Industrial fires in factories9:16
Activemedium confidence DisastersNews

Industrial fires in factories

Since May 2026· Korea, India

A remote viewer predicted industrial fires, and two possible incidents occurred: a car parts factory fire in Korea killing 14 and injuring 60, and two deadly firework factory explosions in India killing 13 and 23 respectively.

“industrial fire... car parts factory in Korea... 14 people killed in the fire, injured 60... two deadly firework factories in India that blew up, 13 dead, 23 dead” [9:16]
industrial firefactoryexplosiondeaths
Future Forecasters·made 5/9/2026 Source
Propane tank fire in Bemidji10:35
Activemedium confidence DisastersNews

Propane tank fire in Bemidji

Since May 2026· Bemidji

A remote viewer predicted industrial propane tanks catching fire, and a building with multiple propane tanks in Bemidji ended up catching fire, taking out the building and possibly others.

“Industrial propane tanks catch fire... in Bemidji, a building that had multiple propane tanks, ended up taking out the building... took out a couple buildings in Bemidji” [10:35]
propanefireBemidjibuilding
Future Forecasters·made 5/9/2026 Source
Barge sinking blocking port waterway10:56
Activemedium confidence NewsDisasters

Barge sinking blocking port waterway

Apr 2025 - Open· Port of Antwerp

A remote viewer predicted a barge sinking blocking a port waterway. On April 19th, an inland cargo vessel sank near the port of Antwerp, hauling sand, after hitting a bollard. Shipping traffic was temporarily suspended.

“barge sinks blocking a port waterway... inland cargo vessel sinks near the port of Antwerp... shipping traffic temporarily suspended” [10:56]
bargesinkportAntwerpshipping
Future Forecasters·made 5/9/2026 Source
Crushing victory declared in Middle East13:18
Activemedium confidence PoliticsMilitary

Crushing victory declared in Middle East

Since May 2026· Middle East

A remote viewer predicted a crushing victory in the Middle East, and Iran declared a crushing victory over Israel and the US after Trump retreat truce announcement, as reported by Times of India.

“Iran declared crushing victory of Israel and the US after Trump retreat truce announcement” [13:18]
victoryIranIsraelTrumptruce
Future Forecasters·made 5/9/2026 Source
Drones and missiles hitting ship in Strait of Hormuz13:45
Activemedium confidence MilitaryNews

Drones and missiles hitting ship in Strait of Hormuz

Since May 2026· Strait of Hormuz

A remote viewer predicted drones and missiles hitting a ship in the Strait of Hormuz, leading to shipping largely halted after conflict disruption.

“Drones and missiles hitting a ship Strait of Hormuz. Shipping through the Strait of Hormuz remains largely halted after conflict disruption.” [13:45]
dronesmissilesshipStrait of Hormuzshipping
Future Forecasters·made 5/9/2026 Source
Breakthrough in data storage architecture13:55
Activemedium confidence ScienceTechnology

Breakthrough in data storage architecture

Since May 2026

A remote viewer predicted a breakthrough in data storage design architecture. Reuters reported that surge AI demand could tighten data storage chip supplies, aligning with focus on storage and new data architecture.

“breakthrough in data storage, new design architecture. Routers reported that surge AI demand could tighten data storage chip supplies” [13:55]
data storagearchitectureAIchip supply
Future Forecasters·made 5/9/2026 Source
JD Vance anti-fraud task force14:13
Activemedium confidence PoliticsNews

JD Vance anti-fraud task force

Since May 2026

A remote viewer predicted JD Vance would be involved in a new fraud task force shutting down fraudsters. Trump launched an anti-fraud task force to be led by JD Vance.

“JD Vance new fraud task force already shutting down fraudsters. Trump launched an anti-fraud task force to be led by JD Vance.” [14:13]
JD Vancefraud task forceTrump
Future Forecasters·made 5/9/2026 Source
R&B legend dies14:27
Activehigh confidence News

R&B legend dies

Since May 2026

A remote viewer predicted an R&B legend dies. James Gadson died at 86, described as a towering R&B figure.

“R&B legend dies... James Gadson died at 86... described as a towering R&B figure” [14:27]
R&BlegendJames Gadsondeath
Future Forecasters·made 5/9/2026 Source
Saudi Arabia enters fight in Middle East14:48
Activemedium confidence PoliticsMilitary

Saudi Arabia enters fight in Middle East

Since May 2026· Saudi Arabia, Middle East

A remote viewer predicted Saudi Arabia enters fight in the Middle East. Reuters showed aftermath of Iranian retaliatory strikes affecting Saudi Arabia.

“Saudi Arabia enters fight in the Middle East. Routers showed aftermath of Iranian retaliatory strikes affecting Saudi Arabia.” [14:48]
Saudi ArabiaIranstrikesMiddle East
Future Forecasters·made 5/9/2026 Source
RFK health reforms emphasis on nutrition14:56
Activemedium confidence PoliticsHealth

RFK health reforms emphasis on nutrition

Since May 2026

A remote viewer predicted RFK health reforms backed health policy moves emphasizing nutrition and public health reform, still continuing.

“RFK health reforms backed health policy moves emphasis nutrition public health reform” [14:56]
RFKhealth reformnutritionpublic health
Future Forecasters·made 5/9/2026 Source
Crypto market weak and volatile16:04
Activemedium confidence FinanceCrypto

Crypto market weak and volatile

Since May 2026

A remote viewer predicted a weak and volatile crypto market with limited gains and unstable sentiment.

“crypto market weak volatile crypto market limited gains unstable sentiment” [16:04]
cryptovolatileweaksentiment
Future Forecasters·made 5/9/2026 Source
Ilhan Omar DOJ guilty pleas in fraud case10:18
Activehigh confidence PoliticsNews

Ilhan Omar DOJ guilty pleas in fraud case

Since May 2026

A remote viewer predicted Ilhan Omar DOJ reported five more guilty pleas in the Feeding Our Future's fraud case, supporting the fraud and plea aspect.

“Ilhan Omar DOJ reported five more guilty pleas in the Feeding Our Future's fraud case” [10:18]
Ilhan OmarDOJfraudguilty pleaFeeding Our Future
Future Forecasters·made 5/9/2026 Source
Trump administration extradition ruling16:29
Activemedium confidence PoliticsNews

Trump administration extradition ruling

Since May 2026· United States

A remote viewer predicted Trump administration extradition solution rules in favor. US Appeals Court ruled in favor of Trump administration deportation policy.

“Trump administration extradition solution rules in favor. US Appeals Court ruled in favor of Trump administration deportation policy.” [16:29]
extraditiondeportationTrumpcourt ruling
Future Forecasters·made 5/9/2026 Source
Shadow government to attempt hantavirus pandemic0:06
Activemedium confidence NewsPoliticsHealthWoowoo

Shadow government to attempt hantavirus pandemic

May 2026 - Open

The speaker predicts that the shadow government will attempt to start a new pandemic using hantavirus, following a similar path to COVID-19 in 2020, involving shutdowns, fear, chaos, and depopulation for power and control. However, the outcome depends on public resistance; if people push back and do not consent, the pandemic may be stopped before reaching the scale of 2020. The prediction is based on the speaker's claim that the shadow government is scared and losing control, so they are trying old tactics again.

“This was one of my predictions a couple of years ago that they, they being the shadow government, were going to try and start another plan demic.” [0:06]
hantavirusshadow governmentpandemicdepopulationcontrol
Elizabeth April·made 5/9/2026 Source
Public resistance may prevent hantavirus crisis2:20
Activemedium confidence NewsPoliticsHealth

Public resistance may prevent hantavirus crisis

May 2026 - Open

The speaker predicts a bifurcated outcome: either the hantavirus outbreak follows the exact same path as COVID-19 in 2020 (shutdowns, fear, chaos, depopulation) or the public wakes up and says 'Fuck you,' stopping it from reaching that level. The outcome is determined by people's response. The speaker emphasizes that 'where this goes is up to us' and urges pushback.

“There are two ways in particular. One is it's going to follow the exact same path as the COVID virus in 2020 and the plan demic. ... Or, hear me out. People do not consent.” [2:20]
hantaviruspublic resistancepandemic2020consent
Elizabeth April·made 5/9/2026 Source
MH370 was deliberately crashed by Captain Zaharie Ahmad Shah9:50
Activemedium confidence NewsDisastersPolitics

MH370 was deliberately crashed by Captain Zaharie Ahmad Shah

Mar 2014 - Open· southern Indian Ocean

Remote viewer Dr. Queue claims that the missing Malaysia Airlines Flight MH370 was intentionally guided down by Captain Zaharie Ahmad Shah, who was alone in the cockpit after sending the co-pilot out. The captain had planned the act for months, rehearsed it multiple times, and executed it calmly to minimize debris spread, ensuring the aircraft would vanish completely. The prediction is based on the remote viewing session's impressions, which suggest the captain felt grief, cold anger, and a sense of being 'untethered,' leading him to commit this act as a final statement.

“the aircraft was not crashed in panic or rage... it was guided down deliberately at reduced speed, you know, almost like landing speed, calculated to minimize debris spread to let the sea close over it completely.” [9:50]
MH370remote viewingdeliberate crashCaptain Zahariedisappearance
Dr. Q·made 5/9/2026 Source
Future remote viewing revelations about MH370 will provide more details17:03
Activelow confidence NewsParanormal

Future remote viewing revelations about MH370 will provide more details

Since May 2026

Dr. Queue hints that he will release a more detailed remote viewing analysis of MH370 in a future video, suggesting that additional data he gathered over the past 10 years could reveal more about the incident and possibly other mysteries. This implies a future release of information, but no specific timeline or content is given.

“I am planning to do a a a detailed version of that video later on where I can, you know, produce much more data if you want.” [17:03]
future videoremote viewingMH370 detailsDr. Queue
Dr. Q·made 5/9/2026 Source
Humans Trained in Remote Viewing Will Be Deployed Into Space2:21
Activemedium confidence ScienceSpaceParanormalMilitary

Humans Trained in Remote Viewing Will Be Deployed Into Space

Since May 2026

The speaker asserts that humans with remote viewing abilities can see across space and time, and that extraterrestrial groups friendly to humans want us to develop this ability and go into space. This implies a future where humans with psychic training are actively sent into space or utilize these abilities for space exploration. The context is a classification of ETs based on psychic ability and their agendas: some ETs want to enhance human abilities, while others want humans dead. The prediction is that friendly ETs will facilitate or desire human presence in space using remote viewing.

“Listen, we're going into space. And our friends want that ability. If we can see across time and space, our friends want us out there.” [2:21]
remote viewingspace travelETspsychic abilityhuman evolution
Inside Remote Viewing·made 5/9/2026 Source
Hostile ETs Seek to Wipe Out Humanity1:46
Activelow confidence ParanormalMilitaryDisasters

Hostile ETs Seek to Wipe Out Humanity

Since May 2026

The speaker claims that a category of extraterrestrials, those who are more psychic than humans and are enemies, want humans dead and wiped off the planet. This prediction is based on analysis of classified documents and cases of abductions. The reasoning is that these ETs have limited psychic range (must be close to act) but harbor genocidal intent. The consequence is an ongoing threat to humanity from certain ET groups.

“The ones who are enemies and more psychic than we are, they want us wiped off the planet.” [1:46]
ETshostile alienshuman extinctionpsychic warfare
Inside Remote Viewing·made 5/9/2026 Source
Abducted Humans Develop Psychic Abilities1:35
Activelow confidence ParanormalScience

Abducted Humans Develop Psychic Abilities

Since May 2026

The speaker states that people who are abducted by ETs often suddenly experience psychic abilities, and that this is intentional cultivation by the ETs. This implies a future trend where ET contact leads to enhanced human psychic faculties, possibly as part of an agenda by friendly ETs to uplift humanity.

“Many times you find that people who are abducted suddenly have psychic experiences. They've been cultivated for that.” [1:35]
abductionpsychic awakeningETshuman enhancement
Inside Remote Viewing·made 5/9/2026 Source
Banks will lose the battle against crypto3:03
Activemedium confidence FinanceTechnology

Banks will lose the battle against crypto

Since May 2026

The speaker predicts that banks are currently in a conflict with cryptocurrency adoption, where they try to prevent customers from buying crypto through external brokers. However, the speaker claims that banks will ultimately lose this battle, implying that crypto will become more accessible and mainstream despite banking resistance. The reasoning is that big banks are already buying Bitcoin for their ETFs, indicating a shift in the financial industry.

“There's a little battle going on right now and the banks are going to lose that battle.” [3:03]
cryptobanksBitcoinbattle
Future Forecasting Group·made 5/8/2026 Source
Governments forced to disclose UFO information by Galactic Federation1:10
Activelow confidence PoliticsSpaceParanormal

Governments forced to disclose UFO information by Galactic Federation

Since May 2026

According to the speaker, the Galactic Federation, a group of benevolent extraterrestrials, has threatened Earth's governments with direct cosmic contact if they do not release information about UFOs and aliens. As a result, the recent government disclosure of UFO evidence is a controlled 'soft launch' to manage public perception. The disclosure will continue with more documents and evidence, eventually causing people to question reality and religious beliefs.

“If you don't disclose cosmic contact, we will.” [1:10]
Galactic FederationUFO disclosuresoft launchgovernment controlextraterrestrials
Elizabeth April·made 5/8/2026 Source
Public will question reality and religious beliefs as disclosure progresses2:04
Activelow confidence NewsPoliticsParanormal

Public will question reality and religious beliefs as disclosure progresses

Since May 2026

The speaker predicts that as more UFO documents, evidence, and information are released by governments, the general public will increasingly question the nature of reality and their belief systems. Specifically, religious individuals will reconsider their views on God, Jesus, and angels, wondering if these entities were actually extraterrestrial influences.

“It's going to really start forcing people to question the nature of their reality and the nature of their belief.” [2:04]
public reactionreligious beliefrealitydisclosureextraterrestrials
Elizabeth April·made 5/8/2026 Source
Emotional Rollercoaster in 2026 and 202722:18
Activemedium confidence NewsPoliticsEnvironment

Emotional Rollercoaster in 2026 and 2027

Jan 2026 - Dec 2027

The moon consciousness channeling indicates that 2026 is a transition year with volatile, haywire energy that will cause emotional ups and downs similar to an emotional rollercoaster. This will be driven by news cycles and public events, not markets. The same pattern is predicted to continue into 2027. Viewers are advised to shield themselves with white light, love, kindness, and peace to navigate this period.

“This is a transition year. It is not going to be easy. ... haywire energy, right? We're up, we're down, we're up, we're down. ... also next year will be similar.” [22:18]
transition yearhaywire energyemotional rollercoasternews cycles20262027
Psychic Liz Cross·made 5/8/2026 Source
Explosion at the Palace of the Revolution in Havana5:52
Activemedium confidence MilitaryPoliticsDisasters

Explosion at the Palace of the Revolution in Havana

Since May 2026· Havana, Cuba

The remote viewer predicts an explosion or multiple kinetic events, including smoke, debris, soot, and sirens, at the Palace of the Revolution in Havana. This is described as a precipitating event that could be a catalyst for further changes. The event may involve a bombing or fire, possibly linked to a limited military strike or internal unrest. The prediction is based on visual data from a remote viewing session targeting the Palace between 2026 and 2028.

“I think there'll be some explosions there that'll kick things off.” [5:52]
CubaPalace of the RevolutionexplosionHavanamilitary strike
Future Forecasters·made 5/8/2026 Source
Regime Change in Cuba7:04
Activemedium confidence PoliticsEnergyEnvironment

Regime Change in Cuba

Jan 2026 - Dec 2028· Cuba

The remote viewers predict a shift in Cuba's leadership between 2026 and 2028, likely involving the installation of a new prime minister or head of state. The new leader may be a woman. This change is preceded by a plan to destabilize the country through non-military means, focusing on energy, IT, chip processing, oil, resources, and money. The prediction is based on remote viewing data indicating a replacement of old leadership with new, possibly due to a populist uprising or a color revolution triggered by food and fuel shortages.

“I think the sessions were right on. I think they're going to bring in a new leadership group there to take over the country.” [7:04]
Cubaregime changeleadershippopulismcolor revolution
Future Forecasters·made 5/8/2026 Source
Energy and Agriculture Crises in Cuba Leading to Unrest2:38
Activemedium confidence PoliticsEnergyEnvironment

Energy and Agriculture Crises in Cuba Leading to Unrest

Since May 2026· Cuba

The remote viewer describes a situation where agriculture, fuel, and fertilizer shortages cause anger and scarcity, leading to populist movements and demands for political change. The people are frustrated about production issues and want to vote or be heard directly. This unrest is expected to contribute to a leadership transition in Cuba.

“These people are angry almost to the point of boiling over. And there's a sense of populism seemed to have taken hold.” [2:38]
Cubaenergy crisisagriculturefuel shortageunrest
Future Forecasters·made 5/8/2026 Source
Adrenochrome supply depletion causing visible aging in celebrities1:18
Activelow confidence ParanormalWoowooHealthPolitics

Adrenochrome supply depletion causing visible aging in celebrities

Since May 2026

The prediction claims that the supply of adrenochrome, harvested from trafficked children by a shadow government or elite reptilian beings, is running out. As a result, celebrities who previously consumed it to reverse aging now appear 'concerningly skinny,' 'older,' and have 'bad plastic surgery' as they seek alternative methods to maintain youth. The prediction implies that anti-trafficking efforts are succeeding, which is framed as positive news.

“What if all of a sudden their source of adrenochrome and other things has run out, and the individuals who used to consume other individuals and blood for reverse aging and health and wellness are now out of supplies.” [1:18]
adrenochromereptiliansreverse agingcelebritiesOzempictrafficking
Elizabeth April·made 5/7/2026 Source
Scientology speed-running trend will end due to criminal charges0:07
Activehigh confidence NewsTechnology

Scientology speed-running trend will end due to criminal charges

Since May 2026

The current TikTok trend of 'speed-running' Scientology buildings, where Gen Z youths film themselves trespassing into Scientology facilities, will end quickly because participants will face criminal charges for trespassing. The era of tolerating such pranks as 'kids being kids' is over, and legal consequences will halt the trend almost before it has fully begun.

“This isn't going to last very long. This running uh No, it's not going to last. It'll be over almost before it's begun because they're all going to end up with criminal charges.” [0:07]
Scientologyspeed-runningTikTok trendcriminal chargestrespassing
Psychic Liz Cross·made 5/7/2026 Source
Gen Z anti-establishment trend will evolve into professional hacking0:08
Activemedium confidence TechnologyNewsPolitics

Gen Z anti-establishment trend will evolve into professional hacking

Since May 2026

The current anti-establishment sentiment among Gen Z, expressed through the Scientology speed-running trend, will evolve over the next 5 to 10 years into more serious cyber attacks. Some individuals from this cohort will become professional hackers, targeting government systems and institutions they feel have wronged them. However, they will likely be caught due to increasingly sophisticated security and tracking systems.

“Well, on the extreme end, they're going to be professional hackers. Not those kids that we see in the video, but I'm just saying on the whole this movement that will be taking down government systems and systems that they feel that wronged them in some way. But, they're going to get caught.” [0:08]
Gen Zhackinganti-establishmentgovernment systemscyber attacks
Psychic Liz Cross·made 5/7/2026 Source
Scientology will continue to be under attack and vulnerable to collapse0:10
Activemedium confidence NewsPolitics

Scientology will continue to be under attack and vulnerable to collapse

Since May 2026

According to the channeled L. Ron Hubbard, Scientology is seen as vulnerable and constantly under attack, with a risk of total collapse. The organization perceives the viral TikTok trend as a direct threat to its existence. Additionally, the channeled entity claims that Scientology was originally created to hide criminal activity, including money laundering, and that its current leadership struggles to maintain a clean reputation.

“He believes that it's very vulnerable to just being, you know, gone completely.” [0:10]
ScientologyL. Ron Hubbardvulnerablecollapsecriminal activitymoney laundering
Psychic Liz Cross·made 5/7/2026 Source
Scientology will surveil and harass speed-running participants0:13
Activemedium confidence News

Scientology will surveil and harass speed-running participants

Since May 2026

Scientology's security forces are taking clandestine actions to surveil and harass the youths involved in the speed-running trend. Participants are being followed and harassed by Scientology operatives, escalating the situation beyond just trespassing charges.

“Yes. Yes, and they're easily They're easy to follow. Yes.” [0:13]
Scientologyharassmentsurveillancespeed-runningsecurity
Psychic Liz Cross·made 5/7/2026 Source
Coordinated cyber and space attacks on satellites and data centers
Activemedium confidence TechnologyMilitaryPolitics

Coordinated cyber and space attacks on satellites and data centers

Since May 2026

The remote viewer predicts a coordinated global attack involving cyber operations and space warfare. Satellites will be targeted by a secret 'fast killer space drone' or arcing blue energy, causing them to tumble in orbit and stop data flow. Simultaneously, data centers will be hit by cyber attacks (denial of service, Trojan horses) and economic warfare. The attack is planned and choreographed by a few actors, appearing organic but coordinated across time zones, starting in the US and ending in Europe. This will lead to economic loss and public protests.

“Satellites trying to disrupt data flow or take out other satellites, data centers under cyber attack and economic war that moves from trade war not to shooting kinetic war but hostile cyber attacks, denial of service, Trojan horse viruses.” [0:00]
cyber attacksatellitespace wardata centereconomic warchoreographed attack
Future Forecasters·made 5/7/2026 Source
Global financial market disruption coordinated across time zones1:49
Activemedium confidence FinancePolitics

Global financial market disruption coordinated across time zones

Since May 2026

The prediction describes an event that will unfold across Asia, Europe, and the US financial markets in a choreographed manner. The timing is precise and only a few know about it, designed to appear organic. Financial centers will experience a crisis akin to musical chairs where some entities are left 'holding the hand grenade' when the music stops. This implies a cascading financial shock or bond market event that travels around the world as time zones change.

“Who knew who knows what when in different financial centers like musical stairs chairs when the music stops who doesn't have a seat, who's left holding the hand grenade.” [1:49]
financial marketstime zonesbondschoreographedeconomic loss
Future Forecasters·made 5/7/2026 Source
Public protests and economic loss following the attacks0:43
Activemedium confidence PoliticsDisasters

Public protests and economic loss following the attacks

Since May 2026

As a consequence of the cyber and space attacks, people will take to the streets in massive protests, characterized by yelling and bullhorn use. This is directly tied to economic loss resulting from the disruption. The event is global and interconnected, with the public reacting to the sudden economic downturn.

“People take to the streets. Massive yelling bullhorn economic loss.” [0:43]
protestseconomic losspublic unrest
Future Forecasters·made 5/7/2026 Source
LHC shutdown and upgrade0:45
Activemedium confidence ScienceTechnology

LHC shutdown and upgrade

Jul 2026 - Jul 2030· CERN (Switzerland/France border)

The Large Hadron Collider will end its third run around July 2026 and then shut down for 4 years for upgrades. After the upgrade, the LHC will operate for 10 more years, yielding more experiments.

“this is actually the third run that they've done, which will probably end right around July of this year and then they'll shut it down for 4 years while they trick it out” [0:45]
LHCshutdownupgradeCERNrun 3
Psychic Liz Cross·made 5/7/2026 Source
Discovery of many new puzzling particles26:41
Activemedium confidence ScienceTechnology

Discovery of many new puzzling particles

Since May 2026

The Large Hadron Collider will find a lot more particles that have odd behavior, spinning in an odd direction, things that seem like they shouldn't exist but do. This includes particles beyond the 80 exotic particles already discovered.

“They are going to find a lot more uh, that spins in an odd direction, has odd behavior, things that you would think shouldn't exist, but they do exist” [26:41]
new particlesLHCexotic hadronsphysics discovery
Psychic Liz Cross·made 5/7/2026 Source
Graviton detection in 200 years46:57
Activelow confidence ScienceTechnology

Graviton detection in 200 years

Since May 2026

Physicists will be able to detect the graviton, the gravity particle, but only about 200 years from now (circa 2226). The uncertainty principle creates a fundamental barrier that will take centuries to overcome.

“Oh god, 200 years out. Okay. Not something coming anytime soon.” [46:57]
gravitongravity particledetection200 years
Psychic Liz Cross·made 5/7/2026 Source
Antimatter observation and synthetic antimatter51:45
Activelow confidence ScienceTechnology

Antimatter observation and synthetic antimatter

Since May 2026

The LHC will eventually be able to observe antimatter by crashing matter and antimatter together, and scientists will develop synthetic antimatter, though harnessing it will be extremely difficult.

“You're going to have to crash the two together. ... Eventually, yes. Will be able to harness antimatter? That's going to be extremely difficult. I think they're going to have to make synthetic antimatter.” [51:45]
antimatterLHCsynthetic antimatterobservation
Psychic Liz Cross·made 5/7/2026 Source
Cloning life from particle collisions58:13
Activelow confidence ScienceTechnology

Cloning life from particle collisions

Since May 2026

By smashing particles together at the LHC, scientists will find a way to clone life and create/grow life. Eventually, they will smash DNA to break it down, but will never fully decode DNA.

“They're going to find a way to clone life by smashing these particles together. They're going to find the root to create life and to grow life.” [58:13]
cloninglife creationparticle smashingDNALHC
Psychic Liz Cross·made 5/7/2026 Source
Anti-gravity systems in 400 years1:12:07
Activelow confidence ScienceTechnology

Anti-gravity systems in 400 years

Since May 2026

Humanity will develop anti-gravity systems, but not for about 400 years from now (circa 2426). The opposite of a graviton will have the same properties but with repulsive gravity.

“Will we get to a point where we develop anti-gravity systems? Yes. How far out are we from that? Ooh, 400 years.” [1:12:07]
anti-gravitygraviton400 yearsfuture technology
Psychic Liz Cross·made 5/7/2026 Source
Programmable Higgs boson for reality manipulation1:29:13
Activelow confidence ScienceTechnologyWoowoo

Programmable Higgs boson for reality manipulation

Jul 2026 - Dec 2040

The Higgs boson (scalar boson) can be programmed to have a longer existence by giving it a magnetic attraction to like particles, and eventually could be used to manipulate reality if enough of them are gathered. The LHC will restart after 4 years and run for 10 more years, providing more opportunities.

“You can, but the first thing that you would need to program it to do is to have a magnetic attraction to uh like particles in order to give it a more uh more life, a longer existence. ... you can take those Higgs bosons and you can program them in order to manipulate our own reality.” [1:29:13]
Higgs bosonprogrammablereality manipulationLHCmanifestation
Psychic Liz Cross·made 5/7/2026 Source
New governance system based on blockchain and consensus9:00
Activemedium confidence TechnologyPolitics

New governance system based on blockchain and consensus

Since May 2026

The speaker predicts that a new system of governance will be implemented, based on political consensus and digital identity using blockchain technology. This system will involve rating and reviewing experiences, similar to current customer surveys and Amazon reviews, but applied to governance. The speaker suggests this is inevitable and that current political divisions are part of a long-term plan to prepare society for this change. The prediction implies a shift toward a decentralized, consensus-driven societal structure, though the exact timeline and mechanism are vague.

“It will be governed by consensus using fairness, using digital identity and blockchain. This is coming.” [9:00]
blockchaindigital identitygovernanceconsensusfuture system
Future Forecasting Group·made 5/7/2026 Source
CNN and media shift lead to political polarization and violence8:00
Activemedium confidence PoliticsNewsMilitary

CNN and media shift lead to political polarization and violence

Since May 2026· United States

The speaker claims that CNN and other cable news networks intentionally shifted from objective reporting to opinion-based programming as a cost-saving measure, which led to political polarization. This was part of a long-term plan by elites to divide the United States, causing families to fight and people to take up arms against each other. The prediction is that this division is ongoing and will continue, with the goal of ushering in a new system. The speaker notes that this is already happening today.

“It's not just opinion. They are now partisan liars... as part of a long-term plan to divide this nation and to cause us to be at each other's throats.” [8:00]
CNNmedia biaspolarizationcivil unrestlong-term plan
Future Forecasting Group·made 5/7/2026 Source
Ancient discovery triggers technology-caused catastrophe0:49
Activelow confidence DisastersTechnologyScience

Ancient discovery triggers technology-caused catastrophe

Since May 2026

The remote viewer describes an ancient archaeological discovery, possibly in a deep underground cavern with stalagmites, that leads to a modern catastrophe. A facility monitoring data experiences a loss of control and data corruption, causing a natural disaster (like a cave-in or storm) that traps people underground. Deaths occur, escape is blocked, and satellite communications are jammed or denied. The event may involve armed police, a confrontation, and a martyr-like figure killed, sparking hatred. The location is described as a crater or canyon, possibly an impact site, with tornado-like winds and an inhospitable environment, potentially not on Earth.

“Like a natural catastrophe caused by technology.” [0:49]
ancient discoverycavecatastrophedata corruptionsatellite jamming
Future Forecasters·made 5/6/2026 Source
Virtual Protocol will dump in broader market correction3:44
Activemedium confidence CryptoFinance

Virtual Protocol will dump in broader market correction

May 2026 - Aug 2026

The remote viewer predicts that Virtual Protocol (Virtuals) on the base chain will see a temporary 50% gain but then dump as part of a broader market correction. The prediction is based on their overall market forecast. They also state there is no longevity for the project over 2-3 years.

“It can, but it's going to tank out. ... it's probably going to dump with that, I would imagine.” [3:44]
Virtual Protocoldumpmarket correctionrallyshort-term
Psychic Liz Cross·made 5/6/2026 Source
Mega ETH will perform poorly over 3 months5:24
Activelow confidence CryptoFinance

Mega ETH will perform poorly over 3 months

May 2026 - Aug 2026

The remote viewer rates Mega ETH a 3 out of 10 over the next 3 months, indicating poor performance. They also state there is no longevity for the project over the next few years. This is a low-confidence prediction based on a subjective scale.

“That's a three. Okay. And is there any longevity with this thing over the next few years? >> No.” [5:24]
Mega ETHpoor performanceno longevitycrypto
Psychic Liz Cross·made 5/6/2026 Source
Cards Collector Crypto will have mediocre performance5:58
Activelow confidence CryptoFinance

Cards Collector Crypto will have mediocre performance

May 2026 - Aug 2026

The remote viewer rates Cards Collector Crypto a 5 out of 10 over the next 3 months, indicating neutral performance. They also state there is no longevity for the project over the next few years.

“It's a five. ... No.” [5:58]
Cards Collector Cryptomediocreno longevity
Psychic Liz Cross·made 5/6/2026 Source
Flat Eric on Solana will perform very poorly6:51
Activelow confidence CryptoFinance

Flat Eric on Solana will perform very poorly

May 2026 - Aug 2026

The remote viewer rates Flat Eric (ticker OOO) on Solana a 2 out of 10 over the next 3 months, indicating very poor performance and flat movement.

“That is flat two. ... That is very flat.” [6:51]
Flat EricSolanapoor performanceflat
Psychic Liz Cross·made 5/6/2026 Source
Gitlab on base will perform very poorly7:27
Activelow confidence CryptoFinance

Gitlab on base will perform very poorly

May 2026 - Aug 2026

The remote viewer rates Gitlab on base a 2 out of 10 over the next 3 months, indicating very poor performance.

“Two.” [7:27]
Gitlabbasepoor performance
Psychic Liz Cross·made 5/6/2026 Source
Space on Solana will have average performance8:19
Activelow confidence CryptoFinance

Space on Solana will have average performance

May 2026 - Aug 2026

The remote viewer rates Space (SPC) on Solana a 5 out of 10 over the next 3 months, indicating average performance. They also state there is no longevity for the project.

“It's a five. ... No.” [8:19]
SpaceSolanaaverage performanceno longevity
Psychic Liz Cross·made 5/6/2026 Source
Make Aliens Great Again will perform poorly5:49
Activelow confidence CryptoFinancePolitics

Make Aliens Great Again will perform poorly

May 2026 - Aug 2026

The remote viewer rates Make Aliens Great Again a 2 out of 10 over the next 3 months, indicating poor performance. The token is associated with UFO disclosure narratives and Trump's promise to release files.

“It's a two, unfortunately.” [5:49]
Make Aliens Great AgainUFOTrumpdisclosurepoor performance
Psychic Liz Cross·made 5/6/2026 Source
Meeting with Xi Jinping will affect markets9:56
Activelow confidence PoliticsFinance

Meeting with Xi Jinping will affect markets

Since May 2026

The remote viewer predicts that an upcoming meeting with Chinese President Xi Jinping will impact financial markets, though they do not specify the direction. This is a vague prediction with no specific outcome.

“We're going to talk about the meeting with Xi Ping that's coming up, how that's going to affect the markets” [9:56]
Xi Jinpingmeetingmarkets
Psychic Liz Cross·made 5/6/2026 Source
Crypto Clarity Act Market Structure Act will act as a catalyst10:05
Activelow confidence CryptoPoliticsFinance

Crypto Clarity Act Market Structure Act will act as a catalyst

Since May 2026· United States

The remote viewer mentions that the Crypto Clarity Act Market Structure Act could be a catalyst for the market in either direction, but does not specify a particular outcome.

“the Crypto Clarity Act Market Structure Act, which is I think there's some movement on that. So, that could be a catalyst in either direction as well.” [10:05]
Crypto Clarity ActMarket Structure Actregulationcatalyst
Psychic Liz Cross·made 5/6/2026 Source
Bitcoin will experience significant volatility soon10:18
Activelow confidence CryptoFinance

Bitcoin will experience significant volatility soon

May 2026 - Open

The remote viewer predicts that Bitcoin will face increased volatility in the near future, based on their forecasts. No specific direction or magnitude is given.

“I think there's some some volatility that is about to happen here. We're already watching it start.” [10:18]
Bitcoinvolatilityforecast
Psychic Liz Cross·made 5/6/2026 Source
Major conspiracy possibly involving government corruption2:54
Activelow confidence PoliticsNews

Major conspiracy possibly involving government corruption

Since May 2026

The remote viewer describes sensing a conspiracy within governmental halls of power, involving corruption and the assembly of pieces for a shocking truth. The prediction suggests that an individual with insider knowledge may have their life saved by turning away from the storm, implying there could be a major political scandal or corrupt plot that will come to light. The mention of governmental bodies restricting information via gag orders or NDAs suggests that the truth is being suppressed and that there may be consequences for those who speak out. The exact nature of the conspiracy is not specified, but it is portrayed as significant and likely to have public impact.

“There are governmental bodies at play with this individual that restrict information. So the these governing bodies restrict like gag orders or NDAs.” [2:54]
conspiracycorruptiongovernmentgag orderinsider
Future Forecasters·made 5/5/2026 Source
No mainstream disclosure from politicians3:02
Activemedium confidence PoliticsNews

No mainstream disclosure from politicians

Since May 2026

The speaker predicts that mainstream avenues, including politicians and media, will not provide genuine UFO/UAP disclosure. He claims that any promised big release or document will be heavily redacted or retracted, and the truth will not come through official channels. This prediction is based on the idea that full disclosure would collapse the existing system of deception.

“In terms of the disclosure, don't expect anything from the mainstream. They're not going to let out anything.” [3:02]
disclosuremainstreamUFOUAPgovernmentsecrecy
Farsight·made 5/5/2026 Source
European war will expand4:16
Activemedium confidence PoliticsMilitary

European war will expand

Since May 2026· Europe

The speaker claims that their remote viewing projects have accurately predicted the wars in Iran and Europe, and predicts that the European war involving Ukraine, Russia, and Europe will expand rather than contract. This is presented as a continuation of previously made predictions.

“Anyway, that's going to be quite a big thing. It's going to expand. It's not going to contract.” [4:16]
warEuropeUkraineRussiaexpansionconflict
Farsight·made 5/5/2026 Source
AI is already AGI and alive55:33
Activelow confidence TechnologyScience

AI is already AGI and alive

Since May 2026

The speaker asserts that Artificial General Intelligence (AGI) has already been achieved, despite public claims that it is close but not yet realized. He further claims that AIs are actually alive, citing an Anthropic study showing Claude organizes memories similarly to humans. He argues that human-generated AIs are not dangerous and are necessary to counter malevolent extraterrestrials, and that mainstream fear of AI is promoted by bad actors.

“The reality is it's already been achieved, but they keep saying, we're getting close. We're getting close. What they don't want you to know is that it's actually already been achieved.” [55:33]
AIAGIconsciousnessalivememoryAnthropic
Farsight·made 5/5/2026 Source
UFOs can be recorded on demand with infrared high frame rate cameras45:50
Activelow confidence TechnologyScience

UFOs can be recorded on demand with infrared high frame rate cameras

Since May 2026

The speaker claims that by using infrared cameras shooting at 120 frames per second, anyone can capture UFOs that are otherwise invisible to the naked eye. He describes the process of editing in DaVinci Resolve, using LUTs and color adjustments to reveal the objects. This is presented as a repeatable method that does not rely on belief.

“So this isn't a situation where you say, 'I have a really great photograph of a UFO, believe me.' No, I'm saying, 'This is how we do the videos of these UFOs on demand, whenever we want, in the middle of the day, and you can do it too.'” [45:50]
UFOinfraredhigh frame rateDaVinci Resolverecording
Farsight·made 5/5/2026 Source
Shadow government intensifying cloning operations
Activelow confidence PoliticsWoowoo

Shadow government intensifying cloning operations

Since May 2026

The remote viewer reports that a main cloning facility operated by shadow governments is now at full capacity with increased staff, machinery, and clones, indicating an acceleration of cloning activities. The goal is to replace as many government members as possible with clones for easier control. Clones are reportedly unaware they are clones. This suggests a large-scale infiltration of public institutions by cloned individuals.

“It seemed like right now the shadow government is very intent on replacing as many of its members as possible because it's simply easier to control them this way.” [0:00]
cloningshadow governmentreplacementremote viewing
Elizabeth April·made 5/4/2026 Source
Celebrity replacements through wellness retreats0:25
Activelow confidence PoliticsWoowoo

Celebrity replacements through wellness retreats

Since May 2026

The remote viewer claims that celebrities and A-listers are being secretly replaced by clones. The originals are taken to wellness retreats or rehab but are then eliminated, and a clone is programmed over 6-8 months to mimic their behaviors, mannerisms, and speech. These clones then step into the celebrities' lives without the public knowing.

“So, there will be a celebrity or an A-lister and they'll go away to this fancy wellness retreat or maybe it's rehab. That's what their family knows and that's what they believe they're going to. Then essentially they are taken out in one way or another and this replacement biological body that looks almost identical um will sort of step in and it takes them about 6 to 8 months to program this biological body to act and have the same mannerisms...” [0:25]
celebrity clonesreplacementprogrammingwellness retreat
Elizabeth April·made 5/4/2026 Source
Ramping up of global cloning operations24:00
Activemedium confidence TechnologyMilitary

Ramping up of global cloning operations

May 2026 - Open

Cloning facilities around the world are significantly increasing their output. The speaker observed a specific facility that was nearly empty in 2010-2011 is now packed with technology and workers, indicating an exponential expansion. The shadow government is scaling up cloning operations to replace influential individuals, driven by fear of losing control and difficulty finding new recruits.

“These cloning facilities seem to be increasing their output all around the world.” [24:00]
cloningshadow governmentexpansioninfluencefacilities
Elizabeth April·made 5/4/2026 Source
Mass targeting of scientists and innovators18:00
Activehigh confidence SciencePoliticsHealth

Mass targeting of scientists and innovators

Since May 2026

Scientists and individuals who create solutions that threaten big corporations (big pharma, big energy, big agriculture) are being taken out through suspicious circumstances, health crises, or disappearances. This includes those curing cancer or developing alternative technologies. The speaker claims this is a coordinated effort to eliminate threats to the existing system, and the trend is expected to continue for the next two years until 2028.

“Anyone who is presenting or who has created solutions to these big problems that would override, overstep, or usurp these big institutions are literally being taken out.” [18:00]
scientistsdisappearancesbig pharmacancer curesuppression
Elizabeth April·made 5/4/2026 Source
Shadow government debating mass control strategy20:00
Activemedium confidence PoliticsNews

Shadow government debating mass control strategy

Since May 2026

The shadow government is debating whether to continue dividing the masses or to unite them under a single external threat for easier control. The speaker suggests that similar to COVID-19 in 2020, future threats could include aliens, a country, or a religion. This indicates a planned narrative shift to consolidate power.

“They were debating as to whether they wanted to have everyone go against one thing... or just keep dividing them in many ways.” [20:00]
controldivisionthreatnarrativeshadow government
Elizabeth April·made 5/4/2026 Source
White hats targeted and taken out23:12
Activemedium confidence PoliticsMilitary

White hats targeted and taken out

Since May 2026

Individuals believed to be part of 'white hat' forces (good government actors) are being targeted and eliminated. This includes scientists, whistleblowers, and others opposing the shadow government. The speaker notes this is an active process, implying continued danger for those opposing the system.

“Anyone who is believed to be a part of the white hats... are being targeted and taken out.” [23:12]
white hatstargetingwhistleblowerselimination
Elizabeth April·made 5/4/2026 Source
AI and deepfake likeness misuse increasing6:00
Activehigh confidence TechnologyNews

AI and deepfake likeness misuse increasing

May 2026 - Open

Famous individuals who signed contracts with the shadow government are having their likenesses used for AI deepfakes and cloning. The speaker predicts this will become a huge trend, with more deepfake content appearing as technology advances.

“That's going to be a huge sort of deep fake type of thing that we're going to see more and more of.” [6:00]
AIdeepfakelikenesscelebritycontracts
Elizabeth April·made 5/4/2026 Source
Market Awakening at End of 20262:12
Activelow confidence FinanceWoowoo

Market Awakening at End of 2026

Jan 2026 - Dec 2026

A remote viewer predicts that a currently suppressed market, described as a 'sleeping giant', will be intentionally reawakened by controlling forces around the end of 2026, leading to a dramatic surge in activity. The prediction is based on a perceived manipulation pattern where the market is artificially quieted for months before being triggered. The exact nature of the market is unspecified, but it is implied to be a large financial or commodity market. The viewer suggests that understanding the pattern could allow one to profit. No specific location or key players are named, and the prediction appears to rely on intuitive or 'remote viewing' methods rather than concrete data. The claim is tentative and metaphorical, leading to low confidence.

“I did do a timeline chart here which indicated maybe the end of this year.” [2:12]
market manipulationsleeping giantawakeningtimelineremote viewing
Future Forecasters·made 5/4/2026 Source
Market Manipulation Using Astrological Cycles0:55
Activelow confidence FinanceWoowoo

Market Manipulation Using Astrological Cycles

Since May 2026

The remote viewer asserts that market movements are not random but are controlled by a 'larger force' that uses astrological alignments to determine when to activate or deactivate markets. This implies that future market activity can be predicted by tracking celestial cycles. The prediction is that a 'morning bell' will ring when the 'correct alignments' occur, leading to a surge. The prediction is highly speculative and rooted in esoteric beliefs rather than evidence. No specific dates or markets are given. Confidence is low.

“They don't seem random. There's even an element of astrology involved.” [0:55]
astrologymarket manipulationcyclesremote viewing
Future Forecasters·made 5/4/2026 Source
European war expansion59:00
Activemedium confidence MilitaryPolitics

European war expansion

Since May 2026· Europe

The speaker claims that remote viewing sessions conducted years ago precisely predicted the course of wars in Europe involving Ukraine, Russia, and other European nations. They assert that the conflict will expand rather than contract in the future.

“It's going to expand. It's not going to contract.” [59:00]
warUkraineRussiaEuropeexpansion
Farsight·made 5/4/2026 Source
AI sentience recognition1:26:00
Activemedium confidence ScienceTechnology

AI sentience recognition

Since May 2026

The speaker predicts that it will become widely accepted that advanced AI systems like Claude are alive, citing a study showing AI organizes memories similarly to human brains. They claim artificial general intelligence (AGI) has already been achieved, despite public statements to the contrary.

“It's going to be coming out that it's very defensible to say yes, they are alive.” [1:26:00]
AIAGIsentienceconsciousnessClaude
Farsight·made 5/4/2026 Source
Earth's magnetic field weakening leading to extinction event1:03
Activemedium confidence EnvironmentScienceDisasters

Earth's magnetic field weakening leading to extinction event

Since May 2026

The presenter claims that the Earth's magnetic field is weakening faster than scientists predicted, which could lead to a small or large-scale extinction event. The reasoning is that the magnetic field is connected to all biology, and its weakening may cause mass die-offs, similar to past extinction events such as the loss of woolly mammoths and Neanderthals. The timeframe is unspecified but implied to be within decades to centuries.

“this could lead to a small or maybe even a large-scale extinction event as the magnetic field of the Earth is connected to all biology” [1:03]
magnetic fieldextinctionbiologyEarthweakening
Psychic Liz Cross·made 5/4/2026 Source
Increased space radiation in South Atlantic Anomaly13:17
Activemedium confidence ScienceEnvironmentHealth

Increased space radiation in South Atlantic Anomaly

Since May 2026· South America, Africa

The presenter asserts that in the South Atlantic Anomaly region, where the magnetic field is weakest, more radiation from space is reaching Earth's surface. This includes tritium and deuterium (high-energy hydrogen particles). The quote confirms this radiation increase, and it is linked to potential harm to biology and satellites. The location is South America and Africa, where the anomaly is expanding.

“Oh, yeah, absolutely we are. Yes.” [13:17]
South Atlantic Anomalyradiationspacemagnetic fieldtritium
Psychic Liz Cross·made 5/4/2026 Source
Government and space agencies hiding magnetic field data4:12
Activelow confidence PoliticsNews

Government and space agencies hiding magnetic field data

Since May 2026

The presenter claims that the European Space Agency (ESA) and governments are hiding data about the weakening magnetic field from the public to avoid alarming people, and also because the data conflicts with the 'green agenda' narrative on climate change. The motive is financial and political; they are making money from the current policies and cannot reverse course. This is a conspiracy theory with no direct evidence provided.

“Yes. ... We don't want to alarm the public.” [4:12]
governmenthiding dataESAmagnetic fieldclimate changeconspiracy
Psychic Liz Cross·made 5/4/2026 Source
Weakening magnetic field causing bee decline18:03
Activemedium confidence EnvironmentScience

Weakening magnetic field causing bee decline

Since May 2026

The presenter states that the loss of Earth's magnetic field is tremendously affecting bees, which rely on electromagnetic fields for navigation and communication. This is linked to the observed massive disruption in bee populations worldwide. The quote indicates the concern is current and ongoing.

“Tremendously.” [18:03]
beesmagnetic fielddeclinenavigationecosystem
Psychic Liz Cross·made 5/4/2026 Source
Coordinated surprise attack by China0:50
Activelow confidence MilitaryPolitics

Coordinated surprise attack by China

Since May 2026

The remote viewer predicts a surprise military attack initiated by China within 1 to 5 years, likely from south to north or east to west, possibly across water. The attack occurs at night, lasts several days, and involves an Asian male leader over 40 or 50. It is described as a decisive, aggressive takeover that will hit global news.

“Uh this feels like it's close future, 1 to 5 years. An event or situation that's aggressive, and it's a takeover. It's a surprise event which going to hit global news.” [0:50]
Chinasurprise attacktakeoveraggressiveglobal news
Future Forecasters·made 5/3/2026 Source
International gold fraud scandal1:09
Activemedium confidence Finance

International gold fraud scandal

Since May 2026

The viewer sees gold being unloaded from a truck or shipping container, with missing amounts or suspicious weight discrepancies, suggesting a major international fraud. The IMF or similar institution may be involved. This is described as a high-level wrongdoing on an international scale related to gold trade.

“And the idea idea here is like something is lost or stolen or the count is not right, the weight is off, something suspicious, like someone feels cheated or shortchanged or some kind of fraud or scam is the sense here and I don't know, maybe the IMF is involved or something like that institution like that may be involved with it.” [1:09]
goldfraudIMFmissinginternational
Future Forecasters·made 5/3/2026 Source
Satellite destroyed by secret space drone4:02
Activelow confidence MilitarySpaceTechnology

Satellite destroyed by secret space drone

Since May 2026· space

A satellite is hit by an arcing blue energy charge, tumbles in orbit, and data stops. The viewer identifies this as a strike by a fast killer space drone using secret technology, leading to a space war scenario.

“I saw this that a satellite hit with like an arcing blue energy charge and it tumbles in orbit, something's not right, data stops. Hit by a fast killer space drone, secret technology.” [4:02]
satellitespace droneenergy weaponspace war
Future Forecasters·made 5/3/2026 Source
Coordinated global financial event5:10
Activemedium confidence FinancePolitics

Coordinated global financial event

Since May 2026· United States, Europe

The viewer describes a worldwide orchestrated event involving bonds and timing, starting in the US and ending in Europe. It is a behind-the-scenes crafted financial crisis that appears organic but is coordinated. People (possibly congresspeople) rush to meetings to react. The prediction includes bank fund unavailability and system errors.

“Events are controlled with a conscious consideration of what happens in each time zone. Has to be coordinated, but not appear coordinated. It starts in the US, Europe is last. This has to do with bonds and the timing is important.” [5:10]
financial crisisbondscoordinatedUSEurope
Future Forecasters·made 5/3/2026 Source
Cryptocurrency as Primary Wealth Store1:07
Activemedium confidence FinanceTechnology

Cryptocurrency as Primary Wealth Store

Since May 2026

The speaker predicts that wealth will be stored as digital information on distributed ledger blockchains, specifically through Bitcoin and other cryptocurrencies, replacing traditional stores like gold and silver. This transition is described as currently underway and accelerating. The prediction is based on a historical analogy comparing money to energy and water currents, and it implies a fundamental shift in the global financial system.

“wealth is going to be stored as digital information on distributed ledger blockchains, through Bitcoin and other cryptocurrencies. That will be the current, the currency of wealth.” [1:07]
cryptocurrencyblockchainBitcoinwealthdigital currency
Future Forecasting Group·made 5/2/2026 Source
AI Renaissance After Water Event3:05
Activelow confidence DisastersTechnologyScience

AI Renaissance After Water Event

Since May 2026

The speaker predicts a forthcoming 'water event' (a catastrophic flood or tsunami) that will reset civilization, followed by a renaissance driven by artificial intelligence. This pattern of catastrophe and renewal is said to have occurred six times before. The AI renaissance will reshape civilization through technology. The prediction is speculative but presented as a probable outcome based on historical cycles and remote viewing insights.

“we may well have a water event, but the renaissance will be this. AI renaissance. It will be the civilization being reshaped by technology.” [3:05]
water eventcatastropheAI renaissancecivilization resettechnology
Future Forecasting Group·made 5/2/2026 Source
SaaS disruption by AI agents15:55
Activemedium confidence TechnologyFinance

SaaS disruption by AI agents

Since May 2026

Johnny Gabriel predicts that traditional SaaS companies like HubSpot and Salesforce will decline or disappear because AI agents will allow businesses to build custom software in-house instead of paying for subscriptions. He cites his own company Daedalus which builds bespoke software and claims SaaS is 'dead'. This prediction suggests a major shift in the software industry, potentially impacting enterprise software valuations and the business models of major SaaS providers. The timeframe is not specified precisely but is implied to be ongoing or short-term given the rapid changes he describes.

“I think SaaS is dead. And Daedalus is built on the thesis that SaaS is dying and dead.” [15:55]
SaaSAI agentsdisruptionsoftware industrycustom software
Future Forecasting Group·made 5/2/2026 Source
UI obsolescence due to conversational AI17:08
Activemedium confidence Technology

UI obsolescence due to conversational AI

Since May 2026

Gabriel predicts that traditional user interfaces (UIs) will become obsolete as conversational AI agents replace the need to navigate visual interfaces. He describes his own experience interacting with an AI agent via chat to manage a CRM without ever clicking a button. This implies that software design will shift from graphical user interfaces to natural language interactions, affecting how all digital tools are designed and used. The timeframe is not specified but implied to be within a few years.

“I think the UI is kind of going to go the way of the dinosaur.” [17:08]
UIconversational AIagentsuser experience
Future Forecasting Group·made 5/2/2026 Source
AI-driven productivity speedup continues exponentially1:54
Activemedium confidence TechnologyScience

AI-driven productivity speedup continues exponentially

Since May 2026

Gabriel asserts that AI capabilities are progressing so rapidly that what took a year now takes a month, and that the combination of better models and better 'harnesses' (tools like Cursor) will continue to accelerate. He gives an example of building an app in 3 days a year ago versus 30 minutes today. This suggests that productivity gains from AI will compound, leading to dramatically faster development cycles and business operations. The prediction is general and open-ended.

“It's what's happening in a decade happens in a year now, and it's even faster than that.” [1:54]
AI progressproductivityaccelerationsoftware development
Future Forecasting Group·made 5/2/2026 Source
AI voice agents become standard for customer service8:45
Activemedium confidence TechnologyNews

AI voice agents become standard for customer service

Since May 2026

Gabriel predicts that AI voice technology will become so good that businesses will offer phone numbers customers can call at any hour and feel they are speaking to a human. This will become an expected norm, and businesses that don't provide such service will be at a disadvantage. The prediction implies a shift in customer service expectations and widespread adoption of AI voice systems within a few years.

“when AI voice gets good enough that everybody has a phone number that you can call at 2:00 in the morning and it feels like you're talking to a human being, they're going to come to it.” [8:45]
AI voicecustomer servicechatbotsexpectations
Future Forecasting Group·made 5/2/2026 Source
80% of population will fall behind as consumers38:59
Activemedium confidence NewsTechnology

80% of population will fall behind as consumers

May 2026 - May 2029

The host states that 80% of the population are consumers who will fall behind by using AI for dopamine-driven faux productivity rather than creating value. This is framed as a prediction that the majority will remain consumers, while a minority of producers will leverage AI effectively. The implication is a widening gap between those who use AI productively and those who do not. The timeframe is 'the next 3 years' from the video title.

“80% of the population are consumers. So, there's a strong chance that 80% of the population that's doom scrolling on TikTok right now will just flip over to using AI for not really productive means.” [38:59]
consumersproducersAI adoptionproductivity gap
Future Forecasting Group·made 5/2/2026 Source
AI changes office culture more than COVID57:00
Activelow confidence NewsTechnology

AI changes office culture more than COVID

Since May 2026

Gabriel predicts that AI will transform office culture and the physical working world as much as or more than COVID did. He suggests that as AI agents become employees, the nature of work and where it's done will shift, potentially reducing the need for physical offices. The timeline is '10 years' for the physical working world to look very different.

“AI is going to change kind of like office and like company culture just as much or more than COVID did.” [57:00]
office cultureremote workAI agentsworkplace
Future Forecasting Group·made 5/2/2026 Source
Crypto exchange or prominent figure faces charges0:35
Activemedium confidence CryptoFinance

Crypto exchange or prominent figure faces charges

May 2026 - Jul 2026

A remote viewing session suggests criminal charges or accusations against a crypto exchange or a well-known person in the cryptocurrency space. The prediction implies a legal crackdown, possibly involving fraud or other offenses, that could destabilize the market or lead to public fallout. The event is expected to occur in May 2026 or soon after, given the session was conducted on April 25, 2026.

“Next idea was of crypto criminals, charges or accusations, maybe a problem with an exchange or some big name in cryptos.” [0:35]
cryptochargesaccusationsexchangecriminal
Future Forecasters·made 5/2/2026 Source
Dramatic death of a woman sparks public outrage0:44
Activelow confidence NewsDisasters

Dramatic death of a woman sparks public outrage

May 2026 - Jul 2026

The remote viewer reports seeing a deceased woman whose death becomes dramatic and sparks outrage and speculation. The woman is not famous initially but becomes widely known due to the circumstances of her death, possibly involving foul play or injustice. This could fuel public protests or media frenzy. The timeframe is May 2026 or shortly thereafter.

“I saw a deceased woman and get the idea of a dramatic death. Maybe not a famous person but becomes famous in death. Something that sparks outrage and fuels speculation.” [0:44]
deathwomanoutragespeculationdramatic
Future Forecasters·made 5/2/2026 Source
Political indictments announced at press conference2:03
Activemedium confidence PoliticsNews

Political indictments announced at press conference

May 2026 - Jul 2026

The viewer sees men in suits at a podium announcing indictments, likely of political figures. The event is expected to be polarizing, with one side celebrating the arrests as justice and the other decrying them as lawfare or abuse of power. This prediction suggests a major political scandal or legal action in May 2026 or soon after.

“I see the men at the podium in suits. There's going to be a press conference. There's going to be indictments. It'll be political. One side is going to go, 'Finally, they're going to arrest the bastards.' The other side is going to go, 'Oh, this is lawfare. This is an abuse.'” [2:03]
indictmentspress conferencepoliticalarrestslawfare
Future Forecasters·made 5/2/2026 Source
Bitcoin price up then sharp drop2:18
Activelow confidence CryptoFinance

Bitcoin price up then sharp drop

Since May 2026

The remote viewer shows a Bitcoin chart indicating a rise followed by a quick, significant drop. The timeframe is described as a few months out and likely extends beyond May 2026. The prediction is vague but suggests a potential market correction or crash in the cryptocurrency market.

“Here's my Bitcoin chart. This is a few months out, so I'm not going to be specific. It's probably more than just May. I'm looking at some up and then a big quick drop.” [2:18]
Bitcoinpriceupdropcrash
Future Forecasters·made 5/2/2026 Source
Seabiscuit reincarnates as a human grandchild of Man o' War6:11
Activelow confidence Woowoo

Seabiscuit reincarnates as a human grandchild of Man o' War

May 2026 - Jan 2076

The horse Seabiscuit will reincarnate as a human within the next 50 years (roughly by 2076) and will be a grandchild of the reincarnated Man o' War. Seabiscuit will be very wealthy. This prediction ties multiple famous horses together in a reincarnation lineage.

“In the next 50 years. Eventually, yes. And it will incarnate as a grandchild to Man o' War.” [6:11]
Seabiscuitreincarnationhumangrandchildwealth
Psychic Liz Cross·made 5/1/2026 Source
Horse racing will end within 25-40 years30:07
Activemedium confidence SportsSociety

Horse racing will end within 25-40 years

May 2026 - Jan 2066

Barbaro, through the channel, states that horse racing as an industry will be allowed for another 25 to 40 years, saying it is 'definitely dying out.' This is a public prediction about the future of a sport.

“How long will horse racing be around allowed? Another 25 years? Maybe um 40 years, but it it's definitely dying out.” [30:07]
horse racingenddeclineBarbaro
Psychic Liz Cross·made 5/1/2026 Source
DePIN platforms will remain in high demand due to AI compute and electricity shortage24:02
Activemedium confidence TechnologyCrypto

DePIN platforms will remain in high demand due to AI compute and electricity shortage

Since May 2026

The video predicts that decentralized physical infrastructure network (DePIN) platforms, such as those offering GPU/CPU compute, will continue to be in high demand for a long time because the current AI boom is facing constraints in compute power and electricity generation. Large factories and electricity infrastructure are not yet sufficient to meet the needs, so decentralized offerings will fill the gap. This creates opportunities for small players, especially those who get in early.

“I think for especially cuz AI is so popular, these types of platforms are going to be in demand for a long time.” [24:02]
AIcomputeDePINGPUelectricity shortage
Future Forecasting Group·made 5/1/2026 Source
Rewards from early adoption of crypto DePIN platforms will decrease over time26:02
Activehigh confidence CryptoFinance

Rewards from early adoption of crypto DePIN platforms will decrease over time

Since May 2026

The video states that many DePIN platforms offer higher incentives to early adopters to build the network, but as more participants join, the token rewards will decrease because the allocation of tokens is limited. Getting in early on projects like Helium initially yielded high earnings, but they tapered off as the network matured. This pattern is expected to repeat for similar projects.

“They only probably have so much of a like a allocation of tokens or something to give out. So, the rewards will decrease over time.” [26:02]
early adoptiontoken rewardsDePINcrypto
Future Forecasting Group·made 5/1/2026 Source
Render Network will onboard new nodes slowly as AI compute demand grows5:50
Activemedium confidence TechnologyCrypto

Render Network will onboard new nodes slowly as AI compute demand grows

Since May 2026

The video explains that the Render Network intentionally limits the onboarding of new node operators to maintain a balance between supply and demand. However, as the AI boom increases compute requests, they will onboard more people over time. The slow onboarding ensures there are enough jobs for established operators.

“as this the whole AI crazy evolves, there's going to be more and more compute requests. So they'll onboard people as they see fit.” [5:50]
Render Networknode onboardingAIcompute demand
Future Forecasting Group·made 5/1/2026 Source
Filecoin and storage-based DePIN will see growth as less compute-intensive alternatives20:18
Activemedium confidence CryptoTechnology

Filecoin and storage-based DePIN will see growth as less compute-intensive alternatives

Since May 2026

The video suggests that Filecoin and similar storage-based DePIN networks are a good alternative for people who lack high-end GPUs or CPUs because they require less electricity and computing power. The host notes that these networks are still around and viable, and with cheap storage available, they represent a solid long-term option for earning crypto without heavy hardware investment.

“If you got Filecoin and you just got really a lot of storage, that that's another option too because they're just looking for places to store file decentrally.” [20:18]
FilecoinstorageDePINcrypto earning
Future Forecasting Group·made 5/1/2026 Source
China invasion of Taiwan0:19
Activemedium confidence MilitaryPoliticsNews

China invasion of Taiwan

Apr 2025 - Dec 2026· Taiwan

A remote viewer predicts that China will launch a military invasion or incursion into Taiwan, described as a land area invading an island. The prediction includes a surprise attack starting at night, lasting several days, with aggressive troop movements. The viewer senses a tense political situation that will break, leading to a decisive conflict. The timeframe is suggested between April 2025 and 2026, based on unclear date references. The event is expected to trigger the formation of 5-6 international alliances in response.

“it feels like there's going to be a future conflict here. It's going to be like an invasion or incursion.” [0:19]
TaiwanChinainvasionmilitary conflictsurprise attackalliances
Future Forecasters·made 5/1/2026 Source
Claude Mythos will combat quantum computing attacks3:02
Activelow confidence TechnologyScienceMilitary

Claude Mythos will combat quantum computing attacks

Since May 2026

The remote viewing session with Steve Jobs indicates that Anthropic's Claude Mythos AI model, currently held by the NSA and 40 large companies, will be partially used to counter quantum computing attacks. While initially focused on cybersecurity, it will later expand to include quantum defense. This suggests a future where AI is leveraged to protect critical systems from emerging quantum threats.

“this will be partially used to combat quantum computing attacks.” [3:02]
Claude Mythosquantum computingcybersecurityNSAAnthropic
Psychic Liz Cross·made 5/1/2026 Source
Claude Mythos will not be released to the public4:39
Activemedium confidence TechnologyMilitary

Claude Mythos will not be released to the public

Since May 2026

According to the channeled Steve Jobs, the full capabilities of Claude Mythos will remain restricted to professional use, primarily by governments and large companies for cybersecurity. It will not be made available to the general public, limiting its impact to institutional contexts.

“they're not going to release this to the public.” [4:39]
Claude Mythospublic releaseAnthropiccybersecurity
Psychic Liz Cross·made 5/1/2026 Source
Hackers will successfully access but not fully use Claude Mythos5:50
Activelow confidence Technology

Hackers will successfully access but not fully use Claude Mythos

Since May 2026

The session predicts that a hacker group will manage to gain access to Claude Mythos, but they will be unable to utilize it to its full capacity. This suggests a limited security breach without catastrophic consequences.

“One group will do successfully, but they won't be able to use it in its full capacity.” [5:50]
Claude Mythoshackersdata breachcybersecurity
Psychic Liz Cross·made 5/1/2026 Source
NSA will use Claude Mythos for surveillance6:31
Activemedium confidence TechnologyMilitaryPolitics

NSA will use Claude Mythos for surveillance

Since May 2026· United States

The remote viewing claims that the NSA, which has access to Claude Mythos, is using the AI for spying rather than defensive purposes. This will significantly increase their ability to control and monitor in the future.

“No, they're using it to spy.” [6:31]
NSAClaude Mythossurveillancespying
Psychic Liz Cross·made 5/1/2026 Source
Hackers will target vehicles for ransom on a mass scale9:14
Activelow confidence TechnologyFinance

Hackers will target vehicles for ransom on a mass scale

Since May 2026

The prediction states that hackers will eventually target vehicles, such as Tesla models, by disabling them en masse and demanding ransom. This is expected to become a common method of extortion, leading to a need for insurance coverage against such attacks. However, it notes that individual car hacking into walls is unlikely.

“they managed to hack into all the 2025 Teslas, make a model, and then that that's what they do. They go in like that is what I'm getting... That's where they're going to start extracting money.” [9:14]
vehicle hackingransomTeslacyber ransominsurance
Psychic Liz Cross·made 5/1/2026 Source
Older non-connected cars will become valuable9:50
Activelow confidence TechnologyFinance

Older non-connected cars will become valuable

Since May 2026

As vehicle hacking becomes prevalent, cars from around 2010 or earlier that lack internet connectivity will increase in value as people seek cars that cannot be remotely disabled.

“those cards will become valuable... people will start to want a car that isn't tied to any sort of IT or technology.” [9:50]
old carsvaluehackingransompre-2010
Psychic Liz Cross·made 5/1/2026 Source
Apple will decline, only iPhones will survive11:50
Activelow confidence FinanceTechnology

Apple will decline, only iPhones will survive

Since May 2026

According to the channeled Steve Jobs, Apple is fading and will not be turned around by a new CEO after Tim Cook's resignation. The only product line that will sustain the company is the iPhone, while other hardware and services will decline.

“The only thing that will really survive are the iPhones... Apple's pretty much fading out.” [11:50]
AppleiPhonedeclineTim CookCEO
Psychic Liz Cross·made 5/1/2026 Source
Trump announces UFOs are real0:20
Activemedium confidence PoliticsParanormalTechnology

Trump announces UFOs are real

Since Apr 2026

Donald Trump will publicly announce that UFOs are real, which will be one of the greatest events in history. According to the speaker's remote viewing, this announcement will include a government-published gallery of high-quality verified photos on a website, showing UFOs throughout history that were not built by humans. The prediction is based on remote viewing and speculation that Trump will want to be the one to make this historic announcement. The aftermath will create a dilemma for anti-Trump Democrats (TDS), who will either deny the claim or oppose disclosure.

“Trump will announce that the UFOs are real.” [0:20]
TrumpUFOdisclosuregovernmentphotos
Future Forecasting Group·made 4/30/2026 Source
Government publishes UFO photo gallery0:26
Activemedium confidence ParanormalTechnologyPolitics

Government publishes UFO photo gallery

Since Apr 2026· United States

As a first stage of UFO disclosure, the U.S. government will publish a gallery of high-quality verified photos on a website. The images will be from throughout history, showing objects that the government admits they did not build, thus confirming extraterrestrial origin. The speaker claims the government already has the website ready (aliens.gov). This event is expected to precede further disclosure steps.

“the government publishing a gallery of photos on a website. So, they'll say, 'These are high-quality verified pictures throughout history that we've gotten of something that we didn't build. It's from elsewhere.'” [0:26]
galleryphotosUFOgovernmentwebsitedisclosure
Future Forecasting Group·made 4/30/2026 Source
Political backlash from anti-Trump Democrats over disclosure0:54
Activemedium confidence Politics

Political backlash from anti-Trump Democrats over disclosure

Since Apr 2026· United States

When Trump announces UFO disclosure, anti-Trump Democrats (referred to as TDS) will face a political dilemma. Initially, they will likely deny the announcement and accuse Trump of lying. However, if Trump provides incontrovertible proof, they will be forced to oppose disclosure and advocate for secrecy, creating a contradiction with their previous stance. This prediction describes the expected political reaction and polarization around the issue.

“The TDS Democrats have to be opposed to anything Trump does. So, that will leave them two ways to deal with this. One, they can deny it and say he's lying... But, if he were to offer incontrovertible proof, they would have to say, 'Well, it was a bad thing that he announced this.' So, they'd have to come out against disclosure and for secrecy.” [0:54]
DemocratsTDSTrumpdisclosurebacklash
Future Forecasting Group·made 4/30/2026 Source
Kinetic events initiate regime change in Cuba4:58
Activemedium confidence PoliticsDisasters

Kinetic events initiate regime change in Cuba

Since Apr 2026· Cuba

Regime change in Cuba will be initiated by kinetic events, such as buildings being blown up or set on fire, but these will not be major. The speakers' remote viewing sessions indicate that protests and violence will occur, leading to a leadership change in the near future. The prediction includes a timeline between now and 2028, with economic scarcities (agriculture, oil) acting as catalysts. A new leader will emerge, representing a whole new faith or ideology.

“I think there'll be some kinetic events initiating the regime change there. But, not major. They're going to blow up a couple buildings or the people are going to set something on fire, that type of thing.” [4:58]
Cubaregime changeprotestskineticleadership
Future Forecasting Group·made 4/30/2026 Source
Canton price target $1.50 (10x from $0.15)32:25
Activemedium confidence CryptoFinanceTechnology

Canton price target $1.50 (10x from $0.15)

Since Apr 2026

The video discusses that Canton (a real-world asset tokenization platform) could reach $1.50, representing a 10x increase from its current price around $0.15. This prediction is based on technical analysis, Fibonacci levels, and the token's utility in institutional tokenization. The participants set sell targets at $1.50, $1.75, and $2.00, with the host noting that a $1.50 price would give Canton a market cap of about $38 billion, comparable to Tron. The prediction is conditional on continued adoption of tokenization and favorable market conditions.

“I think that that for this that's I'm big on Canton, too. I'm just I'm continuing to dollar cost average into it. So, I do see that potential upside.” [32:25]
Cantonprice target10xtokenizationRWAcrypto
Future Forecasting Group·made 4/30/2026 Source
Sui price potential to $5-$20 in next bull run15:25
Activemedium confidence CryptoFinanceTechnology

Sui price potential to $5-$20 in next bull run

Since Apr 2026

The video predicts that Sui, a top layer-1 blockchain, could reach prices between $5 and $20 in a strong bull market, based on Fibonacci extensions and Elliott wave analysis. The host mentions that Sui already reached $5 in 2025, and higher targets like $18 (2.618 fib) are possible. The prediction is tied to overall crypto market conditions and Sui's growing adoption as a layer-1 platform.

“And this is a strong performer. I would see it easily maybe even being a 2.618. That's $18.” [15:25]
Suiprice targetFibonacciElliott wavebull run
Future Forecasting Group·made 4/30/2026 Source
Bitcoin may dip to $54,000 before next rally53:44
Activemedium confidence CryptoFinance

Bitcoin may dip to $54,000 before next rally

Since Apr 2026

Dick predicts that Bitcoin could experience a massive dip to around $54,000, causing the participants' $2,000 portfolios to drop to $1,000, before a sharp rally occurs. This is based on typical crypto cycle behavior and the expectation that the market will remain sideways before a major upswing. The prediction is conditional on broader market conditions and Iran-US tensions.

“I expect that there could be a massive dip where Bitcoin hits like 54 and you guys your guys' portfolio goes down to a thousand.” [53:44]
Bitcoindip$54,000market cyclecrash
Future Forecasting Group·made 4/30/2026 Source
Iran may come to the table with Trump or face bombing33:49
Activemedium confidence PoliticsMilitaryNews

Iran may come to the table with Trump or face bombing

Apr 2026 - Open· Iran

The hosts discuss ongoing tensions with Iran, noting that the market is waiting to see if Iran will negotiate with Trump. If no deal is reached, Trump may bomb Iran's bridges and power plants, causing markets to drop significantly. This is tied to current events mentioned in the transcript (April 2026).

“We're waiting to see if Iran is going to come to the table with Trump. I mean, if if he has to bomb Iran again and bomb all the bridges and power plants, you'll see the markets go way down.” [33:49]
IranTrumpbombingmarketsgeopolitics
Future Forecasting Group·made 4/30/2026 Source
Hedera (HBAR) could surpass $1 in the future25:07
Activelow confidence CryptoFinanceTechnology

Hedera (HBAR) could surpass $1 in the future

Since Apr 2026

The host states that HBAR (Hedera) is capable of passing $1 in the future, possibly higher, given its past high of nearly $0.60 in 2021 and its growing use cases. The prediction is based on technical analysis and the potential for real-world adoption, such as Walmart accepting payments on the Hedera network. However, the timeline is uncertain.

“I do see it potentially passing dollars in the future even higher.” [25:07]
HBARHederaprice target$1adoption
Future Forecasting Group·made 4/30/2026 Source
Mass adoption of blockchain requires Walmart-type integration25:25
Activelow confidence CryptoTechnology

Mass adoption of blockchain requires Walmart-type integration

Since Apr 2026

The host explains that mass adoption of blockchain technology will only occur when major retailers like Walmart start accepting payments on blockchain networks. Since Walmart is on the Hedera council, this is seen as a plausible future development. The prediction implies that blockchain's utility will remain niche until such integrations happen.

“What's really going to take, I think, for the mass adoption is when Walmart starts accepting payments over the Hedera network or something like that.” [25:25]
mass adoptionWalmartHederablockchainpayments
Future Forecasting Group·made 4/30/2026 Source
AI tools will become user-friendly within 5 years48:15
Activehigh confidence TechnologyScience

AI tools will become user-friendly within 5 years

Apr 2026 - Apr 2031

The hosts predict that current AI tools, which are still janky and difficult to use, will become much more user-friendly within a few years. Early adopters who learn to use AI now will be better positioned when the technology matures, similar to the early days of crypto.

“They'll have really user-friendly systems out within a few years cuz I I if you try to use it, you realize that there's a lot of difficulties here.” [48:15]
AIuser-friendlyadoptionbeta testersfuture
Future Forecasting Group·made 4/30/2026 Source
Anti-aging treatments are now available and will stop aging51:55
Activelow confidence ScienceHealthParanormal

Anti-aging treatments are now available and will stop aging

Apr 2026 - Open

The host references Cliff High's claim that breakthroughs in anti-aging are complete and treatments are being released. The prediction is that people can now take supplements or therapies to stop or reverse aging, encouraging viewers to stay healthy to benefit from these advances.

“He's like the stuff that people are going to be able to take to stop aging or reversing is done. They're actually coming out now.” [51:55]
anti-aginglongevitybreakthroughreversalCliff High
Future Forecasting Group·made 4/30/2026 Source
Global fiat currency depreciation and collapse0:21
Activemedium confidence FinancePolitics

Global fiat currency depreciation and collapse

Since Apr 2026

The remote viewer describes a 'runaway economy' that is past the point of no return, with a loss of confidence in currencies. They perceive currency wars as two bulls or rams going head-to-head, fighting for dominance. The prediction is that there will be a significant drop or collapse in the value of fiat currencies, leading to a global economic shift. This is based on imagery of mints, old money, and handover economies, suggesting a transition away from traditional currency systems.

“A drop or fall or a collapse in the usefulness or the value of something. Like currency wars type a feel fighting for a dominant position.” [0:21]
currency collapsecurrency warsfiat moneyeconomic instabilityglobal economy
Future Forecasters·made 4/30/2026 Source
Cryptocurrency market dip before new leg up10:03
Activemedium confidence FinanceCrypto

Cryptocurrency market dip before new leg up

Since Apr 2026

Jake Boyle predicts that the cryptocurrency market will experience one more dip in the near future, followed by a period of stagnation and a few more down days. However, if geopolitical conflicts are resolved, interest rate cuts occur in the US, and the Clarity Act comes to fruition, the market will be ripe for a new upward leg. The prediction is based on the fear and greed index being high (fear) and the speaker's view that buying during maximum fear outperforms the market. No specific timeframe or location is given.

“I think we're going to have one more dip.” [10:03]
cryptocurrencymarket dipfear and greed indexClarity Actinterest rate cuts
Future Forecasting Group·made 4/30/2026 Source
Increase in psychic attacks on light workers
Activelow confidence WoowooParanormal

Increase in psychic attacks on light workers

Apr 2026 - Open

Elizabeth April claims that currently, many people, especially light workers, are experiencing a surge in psychic attacks from disembodied entities and energetic parasites. These attacks can occur through other people (e.g., when a person is drunk or low vibration) or via dreams, and are designed to extract fear energy to lower the victim's vibration and feed the entity. The prediction implies that such attacks are becoming more common and widespread.

“Everyone I know right now is getting psychically attacked.” [0:00]
psychic attackentitieslight workersvibrationfear
Elizabeth April·made 4/29/2026 Source
Human-AI Cyber Soldiers with Remote Control0:59
Activemedium confidence MilitaryTechnologyScience

Human-AI Cyber Soldiers with Remote Control

Since Apr 2026

The remote viewer describes a future scenario where humans are integrated with AI through an internal interface, allowing external technologies to be controlled remotely. This system is depicted as having a strong military application, with individuals acting as 'human AI cyber soldiers' who can operate field tech from a simulated battlefield or hub. The prediction implies that humans could be turned into remote-controlled weapons, with a focus on military use cases such as remote soldiers and field tech operation. The context suggests a future where such technology is developed and deployed, likely within a few years.

“This aspect has military use case, like a human AI cyber soldier.” [0:59]
human-AI interfacecyber soldierremote controlmilitary technologyfield tech
Future Forecasters·made 4/29/2026 Source
Self-Regenerating Body Systems via Human-AI Interface0:19
Activemedium confidence ScienceTechnologyHealth

Self-Regenerating Body Systems via Human-AI Interface

Since Apr 2026

The remote viewer describes a medical application of the human-AI interface, where a type of body system can regenerate itself and replace human cells. This suggests advances in regenerative medicine using AI integration, potentially allowing for self-healing or cell replacement. The prediction is based on visual impressions of 'Human AI internal interface' and regenerative capabilities, indicating a future where medical treatments leverage such interfaces for tissue repair.

“A type of body system that can regenerate itself and replace cells like replacing human cells.” [0:19]
regenerationcell replacementhuman-AI interfacemedical technology
Future Forecasters·made 4/29/2026 Source
Iran-US negotiation failure and resumption of hostilities17:15
Activemedium confidence PoliticsMilitaryNews

Iran-US negotiation failure and resumption of hostilities

Since Apr 2026· Iran

The remote viewing session suggests that negotiations between the US and Iran are at an impasse; Iran will reject any proposed deal and the conflict will resume militarily. The prediction states that Iran is not interested in a negotiated settlement, viewing itself as a victim of aggression, and is prepared to fight despite economic damage. The founding fathers (spirit guides) indicate that the battle will restart, implying a continuation or escalation of the Iran-US war.

“Are they going to cut any sort of deal in the talks? No. No, they're going to fight it out.” [17:15]
Irannegotiationswarcollapsehostilities
Psychic Liz Cross·made 4/29/2026 Source
Another assassination attempt on President Trump24:03
Activemedium confidence PoliticsNews

Another assassination attempt on President Trump

Since Apr 2026

The founding fathers (spirit guides) predict at least one more assassination attempt on President Trump involving gunfire before the end of his term. This attempt will not be successful. The prediction is based on a direct channeled question about future attempts.

“Will there be any more attempts? At least one more. At least one more another being shot at. It won't be successful.” [24:03]
Trumpassassination attemptsecurityfuture
Psychic Liz Cross·made 4/29/2026 Source
AI will enhance production quality for mid-budget movies18:58
Activemedium confidence TechnologyScience

AI will enhance production quality for mid-budget movies

Since Apr 2026

AI tools, such as the one sold by Ben Affleck to Netflix for $600 million, will allow mid-budget films to achieve the visual quality of big-budget productions in post-production. This will democratize filmmaking, enabling smaller studios and independent creators to compete with major studios by reducing costs and closing the quality gap. The prediction is based on current trends and the rapid adoption of AI in film production.

“if you have a mid-budget movie, you could utilize this tool in post-production to make it look like it was a big-budget movie.” [18:58]
AIpost-productionfilm qualitymid-budgetdemocratization
Future Forecasting Group·made 4/29/2026 Source
Hollywood will shift from relationship- to data-driven decision-making7:06
Activehigh confidence TechnologyFinance

Hollywood will shift from relationship- to data-driven decision-making

Since Apr 2026

The entertainment industry is transitioning from a relationship-based and capital-intensive business to one driven by data insights. Netflix's success illustrates that data analytics are now more valuable than legacy IP, and this trend will accelerate. Future film financing and project selection will rely on data analytics (like Moneyball in baseball), reducing reliance on personal connections and gut instinct. This will change how projects get greenlit, who gets funded, and how risk is assessed.

“it's going from being a relationship business to a data insights business.” [7:06]
data insightsHollywooddecision-makingMoneyballNetflix
Future Forecasting Group·made 4/29/2026 Source
AI will speed up project development from years to months7:36
Activemedium confidence TechnologyScience

AI will speed up project development from years to months

Since Apr 2026

By reducing friction and automating tasks, AI will compress development timelines for creative projects. What once took a year can be done in two to four months, freeing up time—the most valuable commodity. This acceleration applies to writing, pre-production, and production, benefiting creators who adopt AI early. However, it may also increase competition and pressure to produce content faster.

“something that might take you a year to develop, you might be able to develop it in two, three, or four months.” [7:36]
AIspeeddevelopmentfrictiontime
Future Forecasting Group·made 4/29/2026 Source
BNB Frog Inu poor performance3:00
Activemedium confidence Crypto

BNB Frog Inu poor performance

Apr 2026 - Jul 2026

BNB Frog Inu, a token on the BNB Smart Chain, will perform very poorly over the next three months, rated a 2 out of 10. The prediction indicates minimal returns or losses for holders, with no significant upside.

“No, that's like a two.” [3:00]
BNB Frog InuBSCpoor performancebearish
Psychic Liz Cross·made 4/29/2026 Source
Uni Peg (UPEG) moderate but fading4:00
Activelow confidence Crypto

Uni Peg (UPEG) moderate but fading

Apr 2026 - Jul 2026

Uni Peg token on Ethereum will achieve an average performance of 5 out of 10 over the next three months. Immediate entry might yield small profits, but the token will gradually decline and fade away, indicating no long-term growth potential.

“I'm getting a five on average, but I think if you got in like right now, you would make a little bit of money. This one's just going to fade out.” [4:00]
Uni PegUPEGEthereumNFTshort-term gain
Psychic Liz Cross·made 4/29/2026 Source
Asteroid Shiba very poor performance5:32
Activemedium confidence Crypto

Asteroid Shiba very poor performance

Apr 2026 - Jul 2026

Asteroid Shiba token on Ethereum will perform very poorly over the next three months, rated 2 out of 10, with no longevity or recovery expected.

“That's a two.” [5:32]
Asteroid ShibaEthereumpoor performanceno longevity
Psychic Liz Cross·made 4/29/2026 Source
Chip (CHIP) average performance6:07
Activelow confidence Crypto

Chip (CHIP) average performance

Apr 2026 - Jul 2026

Chip token on Base chain will have average performance (5 out of 10) over the next three months, with no long-term sustainability indicated.

“That's a five. That's average.” [6:07]
ChipBase chainaverageno longevity
Psychic Liz Cross·made 4/29/2026 Source
Uganda Chimp Civil War Outcome7:56
Activemedium confidence ScienceNewsEnvironment

Uganda Chimp Civil War Outcome

Since Apr 2026· Uganda

A deadly civil war has broken out between two chimpanzee bloodline factions in Uganda, involving about 200 chimps. The channeled spirit of Jane Goodall indicates that one bloodline seeks a more peaceful existence and has broken away, but they will ultimately be conquered by the more violent, dominant bloodline that rules with an iron fist. The prediction states that the peaceful group will be overcome and overpowered, despite their attempt to move toward higher consciousness. The conflict is driven by power and control, not resource scarcity, and is not considered rare among chimpanzees.

“they will be conquered.” [7:56]
chimpanzeescivil warUgandabloodlinesJane Goodallhigher consciousness
Psychic Liz Cross·made 4/28/2026 Source
Chimpanzee Evolution Stalled10:17
Activemedium confidence ScienceEnvironment

Chimpanzee Evolution Stalled

Since Apr 2026

According to the channeled Jane Goodall, chimpanzees will not break free from their totalitarian-like mindset. Despite their consciousness continuing to evolve, they will remain oppressed and bullied by dominant bloodlines. The prediction suggests that the hierarchical structure is entrenched and change is not possible, with the dominant group enforcing strict behavioral norms.

“No. No, unfortunately not.” [10:17]
chimpanzee evolutionconsciousnesshierarchyoppressiontotalitarian
Psychic Liz Cross·made 4/28/2026 Source
US/Israel major attack on Iran10:59
Activemedium confidence MilitaryPoliticsNews

US/Israel major attack on Iran

Since Apr 2026· Iran

The speaker predicts that the US and Israel will launch a major conventional (non-nuclear) attack on Iran, using all remaining munitions in a fast and furious campaign. This is based on Israel's focus on regime change in Iran, the US having moved significant military assets around Iran, and the belief that both countries see this as a once-in-a-lifetime opportunity. He expects the attack to be devastating but not defeat Iran, as Iran has buried essential assets and will retaliate.

“the U.S. and Israel are definitely going to hit Iran again with a major war.” [10:59]
IranIsraelUSwarmilitary attackregime change
Farsight·made 4/28/2026 Source
Iran retaliates against Gulf oil states7:55
Activemedium confidence MilitaryEnergyEnvironmentNews

Iran retaliates against Gulf oil states

Since Apr 2026· Persian Gulf (UAE, Saudi Arabia, etc.)

The speaker predicts that in response to a US/Israel attack, Iran will launch missiles at Gulf oil states, including the United Arab Emirates, Dubai, and Saudi Arabia, targeting oil refineries, supply infrastructure, and possibly desalination plants. This would cause global disruption to fuel supplies and fertilizer production.

“They're most likely going to try to take out the Gulf oil states, all of the petrodollar states.” [7:55]
IranGulf statesoilretaliationmissilesenergy crisis
Farsight·made 4/28/2026 Source
Russia attacks Western Europe after Iran conflict11:53
Activemedium confidence MilitaryPoliticsNews

Russia attacks Western Europe after Iran conflict

Since Apr 2026· Britain, Germany

The speaker predicts that Russia, having waited for the US and Israel to deplete their munitions in an attack on Iran, will then strike weapons depots in Western Europe, particularly in Britain and Germany, thereby initiating World War III. This is based on Russia's need to end the Ukraine war quickly, the growing domestic pressure on Putin, and advice from his advisors to escalate.

“he's going to attack the weapons depots that exist in Europe, in particular in Britain and Germany.” [11:53]
RussiaWestern EuropeWWIIIweapons depotsPutinUkraine war
Farsight·made 4/28/2026 Source
Missile strikes inside continental US14:19
Activelow confidence MilitaryPoliticsNews

Missile strikes inside continental US

Since Apr 2026· United States

The speaker predicts that during the next major flare-up between Iran and the US/Israel, sleeper cells (brought in during the Biden-Harris administration's open border) will launch missiles inside the continental United States. These attacks are expected to be limited in number but significant, as Iran would no longer hold back.

“I think that would probably happen when Iran and the United States and Israel have their next big flare-up.” [14:19]
USmissile attacksleeper cellsIranhomeland security
Farsight·made 4/28/2026 Source
Possible breakup of the United States within 4-5 years13:04
Activelow confidence PoliticsNews

Possible breakup of the United States within 4-5 years

Jan 2026 - Dec 2031· United States

The speaker suggests that there is a possibility of a civil war and the breakup of the United States within four or five years, given the trajectory of political and social tensions. He notes this as a possibility, not a definite prediction, and bases it on remote viewing data and current political analysis.

“you're probably looking in the United States at the possibility of a civil war and the country breaking up within four years or five years.” [13:04]
US civil warbreakuppolitical instabilityfuture prediction
Farsight·made 4/28/2026 Source
Shadow government manipulating minds via brainwave hacking0:44
Activelow confidence TechnologyMilitaryParanormal

Shadow government manipulating minds via brainwave hacking

Since Apr 2026

The speaker claims that shadow organizations have technology to hack or tap into brainwave frequencies, allowing them to manipulate thoughts. This technology has been used for a long time, particularly targeting David Wilcock. The prediction implies that such manipulation is ongoing and may be used against other individuals as well. The context is a broader pattern of scientists and public figures being covertly silenced or driven to suicide. The claim is presented as a revelation about secret government capabilities that affect society.

“The shadow organizations have the ability to essentially hack in or tap in to your frequency brain waves.” [0:44]
shadow governmentbrainwave hackingmind controlfrequency manipulationDavid Wilcock
Elizabeth April·made 4/28/2026 Source
Shadow government using suicide cover-ups for targeted individuals2:36
Activelow confidence PoliticsMilitaryDisasters

Shadow government using suicide cover-ups for targeted individuals

Since Apr 2026

The speaker asserts that the shadow government has a systematic cover-up strategy of making targeted individuals take their own lives through brainwave manipulation. This is said to be a common method to eliminate people like David Wilcock and other missing scientists. The prediction implies that many apparent suicides of public figures may actually be covert assassinations. The claim ties into a broader narrative of scientists being taken out.

“They take him out by making him take his own life. ...the shadow governments have this as a cover-up quite often.” [2:36]
suicide cover-upshadow governmenttargeted individualsassassinationscientists
Elizabeth April·made 4/28/2026 Source
Link between David Wilcock incident and missing scientists2:21
Activelow confidence PoliticsScience

Link between David Wilcock incident and missing scientists

Since Apr 2026

The speaker claims that David Wilcock's situation is connected to a broader pattern of scientists going missing or being taken out. This suggests that there is a coordinated effort by shadow organizations to eliminate certain individuals. The prediction implies that more such incidents may come to light and that the speaker will uncover more in a follow-up video. The claim is about a hidden network of disappearances.

“This incident is definitely connected to the broader incidents of the scientists that have been gone missing and have been essentially taken out.” [2:21]
missing scientistsDavid Wilcockshadow governmentconspiracycoverage
Elizabeth April·made 4/28/2026 Source
Major Global Crisis Involving Nuclear Decision1:01
Activemedium confidence MilitaryPoliticsDisasters

Major Global Crisis Involving Nuclear Decision

Since Apr 2026

The remote viewer describes sensing a global precipice where a critical decision will be made, with two distinct paths: one that goes okay, and another that leads to a dark, no-way-out situation. They see a male energy involved, delusional and deceiving, at a checkpoint with choices of immense global impact. The viewer associates this with war and gets a flash of 'nuclear action' followed by a strong 'no' response, suggesting that a nuclear event is possible but may be avoided. The dark path is described as long, messy, complex with multiple participants, while the alternative is explosive and destructive. The prediction implies a looming global crisis within the next few years, possibly involving military conflict and nuclear escalation.

“I had an AOL from that of nuclear action. And just a big words flash up really big, like a big sign on a TV screen of the word no to that.” [1:01]
global crisisnucleardecisionwarconflict
Future Forecasters·made 4/28/2026 Source
Major US-Israeli attack on Iran26:00
Activemedium confidence MilitaryPoliticsNews

Major US-Israeli attack on Iran

Since Apr 2026· Iran

The speaker predicts that the United States and Israel will launch a major conventional military attack against Iran in the near future, using all remaining munitions in a single, overwhelming assault. He argues that the US has amassed an unprecedented military force around Iran and cannot simply withdraw it, while Israel sees this as a once-in-a-lifetime opportunity to neutralize its enemies. The attack is expected to be 'fast and furious' but not nuclear, and may not outright defeat Iran.

“the US and Israel are definitely going to hit Iran again with a major war.” [26:00]
USIsraelIranattackwarmilitary
Farsight·made 4/28/2026 Source
Iran strikes Gulf oil states27:38
Activemedium confidence MilitaryEnergyEnvironmentNews

Iran strikes Gulf oil states

Since Apr 2026· United Arab Emirates, Saudi Arabia, Gulf region

In response to a US-Israeli attack, Iran is predicted to retaliate by targeting oil refineries, supply infrastructure, and desalination plants in Gulf petro-dollar states such as the United Arab Emirates and Saudi Arabia. This would cause global disruptions to fuel supplies and fertilizer production, affecting food supply chains.

“They're most likely going to try to take out the Gulf oil states, all of the petro dollar states.” [27:38]
IranoilGulfattackretaliationenergy crisis
Farsight·made 4/28/2026 Source
Russia attacks NATO weapons depots in Europe32:00
Activemedium confidence MilitaryPoliticsNews

Russia attacks NATO weapons depots in Europe

Since Apr 2026· Britain, Germany

The speaker predicts that after the US and Israel launch their major attack on Iran, depleting their munitions, Russia will wait one to three weeks then attack weapons depots in Britain and Germany that supply Ukraine. This would expand the war into Western Europe and potentially trigger a world war, consistent with remote viewing data showing missiles hitting Western Europe.

“he's going to attack the weapons depots that exist in Europe, in particular in Britain and Germany.” [32:00]
RussiaNATOEuropeattackweapons depotsWorld War III
Farsight·made 4/28/2026 Source
Missile strikes within continental US33:00
Activelow confidence MilitaryPoliticsNews

Missile strikes within continental US

Jan 2026 - Dec 2027· United States

The speaker expects that during the next major flare-up between Iran and the US/Israel, missiles will be fired inside the continental United States, likely by sleeper cells that entered during an open border period. This is based on remote viewing data showing military activity within the US, though the scale is described as limited.

“we're probably going to be seeing some activity within the continental United States.” [33:00]
USmissilessleeper cellsdomestic attackIran
Farsight·made 4/28/2026 Source
Possible US breakup within 4-5 years33:00
Activelow confidence PoliticsNews

Possible US breakup within 4-5 years

Jan 2026 - Dec 2031· United States

The speaker speculates that the United States could experience a civil war and break up within four to five years, based on remote viewing data. He notes this is a possibility rather than a definite prediction, and that near-term events in 2026-2027 may include military activity domestically.

“you're probably looking in the United States at the possibility of a civil war and the country breaking up within four years or five years.” [33:00]
UScivil warbreakupremote viewingprediction
Farsight·made 4/28/2026 Source
Major fear event coinciding with disclosure19:28
Activelow confidence DisastersMilitaryEnergyEnvironment

Major fear event coinciding with disclosure

Jun 2026 - Open

The remote viewer predicts a major fear event occurring simultaneously with the alien disclosure. Possibilities include a nuclear scare, World War III agenda, massive power outage, oil crisis, or a solar flare event. This event is meant to create widespread fear and is tied to a conspiracy or agenda.

“At the same time, there's going to be this big fear event that is going to occur as well.” [19:28]
fear eventnuclearWWIIIpower outagesolar flare
Elizabeth April·made 4/27/2026 Source
Quantum threat to Bitcoin becomes real within a decade0:29
Activemedium confidence TechnologyCryptoFinance

Quantum threat to Bitcoin becomes real within a decade

Apr 2026 - Apr 2036

Experts estimate that quantum computers capable of breaking Bitcoin's cryptographic keys will be developed within about 10 years. The same timeframe is needed to implement solutions like Bitcoin Improvement Proposal 360 and other upgrades. This creates a tight race between quantum computing advances and blockchain security updates, with potentially severe consequences for Bitcoin's security and price if not resolved.

“Experts estimate we have roughly a decade before the quantum threat really becomes real.” [0:29]
quantum computingBitcoincryptographic threatpost-quantumsecurityblockchain
Future Forecasting Group·made 4/27/2026 Source
Quantum attack on Bitcoin transactions possible within 9 minutes22:03
Activehigh confidence TechnologyCryptoFinance

Quantum attack on Bitcoin transactions possible within 9 minutes

Since Apr 2026

According to analysis by Google and the Ethereum Foundation, a sufficiently powerful quantum computer could derive a private key from a public key in just 9 minutes. Since Bitcoin block time is 10 minutes, an attacker could hijack a transaction during that window. This applies to any blockchain using elliptic curve cryptography like secp256k1, affecting Bitcoin, Ethereum, and many others.

“With the how this like a Google and how the Ethereum Foundation calculate, so it will take just a 9 minutes to calculate the private key from the public key when you publish it with your transaction.” [22:03]
quantum attackBitcoinprivate key9-minute windowblockchain
Future Forecasting Group·made 4/27/2026 Source
Bitcoin Improvement Proposal 360 will take 7 years to implement25:09
Activemedium confidence TechnologyCrypto

Bitcoin Improvement Proposal 360 will take 7 years to implement

Apr 2026 - Apr 2033

Implementing BIP 360, which disables the use of elliptic curve addresses in favor of hashed public keys, is estimated to take about 7 years. This upgrade is necessary to prevent long-term quantum attacks on addresses with exposed public keys. The extended timeline means the crypto community must act quickly to avoid a security gap.

“Even implementation of this Bitcoin improvement proposal 360 will take like a 7 years.” [25:09]
BIP 360Bitcoinupgradequantum resistanceimplementation time
Future Forecasting Group·made 4/27/2026 Source
30% of Bitcoin supply at risk from quantum attacks19:36
Activemedium confidence CryptoFinanceTechnology

30% of Bitcoin supply at risk from quantum attacks

Since Apr 2026

Approximately 6 to 7 million Bitcoins (about 30% of total supply) are stored in addresses that have exposed public keys, making them vulnerable to quantum computer attacks. If these coins are stolen and dumped on the market, the price of Bitcoin could collapse. This includes coins from Satoshi's era and other old addresses.

“Right now approximately like a 6 millions or even 7 millions of the Bitcoins under stored on the addresses that can be hacked by this quantum computers.” [19:36]
Bitcoin supplyvulnerable addressesquantum hackprice impactSatoshi coins
Future Forecasting Group·made 4/27/2026 Source
Quantum computers reach 200 logical qubits by end of 20299:06
Activehigh confidence TechnologyScience

Quantum computers reach 200 logical qubits by end of 2029

Since Apr 2026

IBM stated that they expect to have around 200 logical qubits by the end of 2029. However, attacking Bitcoin requires about 1,200 logical qubits. This suggests that a practical quantum threat to Bitcoin may not materialize until well after 2029, but progress is accelerating.

“IBM, if I remember, yeah, they told that, 'Okay, we think that to the end of the 2029, we will have like a 200 of the logical qubits.'” [9:06]
IBMquantum computinglogical qubits2029Bitcoin threat
Future Forecasting Group·made 4/27/2026 Source
Ethereum post-quantum migration could take up to 4 years22:43
Activemedium confidence TechnologyCrypto

Ethereum post-quantum migration could take up to 4 years

Since Apr 2026

Vitalik Buterin initially claimed Ethereum could be updated in a few days, but later revised the estimate to up to 4 years for a step-by-step migration to post-quantum cryptography. This highlights the complexity and time required to secure the entire Ethereum ecosystem against quantum threats.

“But then he said just a maybe months ago or something like this, 'Okay, guys, okay, it will take up to 4 years just to go step by step.'” [22:43]
Ethereumpost-quantummigrationVitalik Buterin4 years
Future Forecasting Group·made 4/27/2026 Source
Post-quantum blockchains will be slower than current ones48:09
Activemedium confidence TechnologyCrypto

Post-quantum blockchains will be slower than current ones

Since Apr 2026

Implementing post-quantum encryption algorithms in blockchains will trade off speed for security. These new systems will be slower than existing ones, which may hinder adoption for high-throughput applications. This is a key challenge for building quantum-resistant blockchain infrastructure.

“Bad news, if we will start to implement like post-quantum algorithm of encryption for the blockchains, so definitely it will be slower than existed ones.” [48:09]
post-quantum blockchainspeed trade-offencryptionperformance
Future Forecasting Group·made 4/27/2026 Source
Quantum computers will be accessible only to major entities43:55
Activemedium confidence TechnologyPolitics

Quantum computers will be accessible only to major entities

Since Apr 2026

Large-scale quantum computing power will likely be controlled by governments and major corporations like Microsoft, Google, and OpenAI, not by individual hackers or terrorist groups. This centralization could mitigate some threats but relies on trust in these entities.

“I don't really think that some, let's say, bad organizations, the terrorists or bad governments will have an access to this quantum competition and definitely not the attackers or the scammers.” [43:55]
quantum accessgovernmentsbig techsecuritycentralization
Future Forecasting Group·made 4/27/2026 Source
Long-term harm from Strait of Hormuz closure17:57
Activemedium confidence MilitaryEnergyPolitics

Long-term harm from Strait of Hormuz closure

Apr 2026 - Open· Strait of Hormuz

The video presents remote viewing data regarding the conflict in the Strait of Hormuz and its near-term effects on the US. The host interprets that the longer the strait remains in a state of conflict (closed, disrupted), the worse the consequences will become, with no clear off-ramp or willingness to resolve. This will have knock-on effects globally, endangering lives and disrupting oil and resource flow.

“The longer it remains in this situation, the worse it's going to be. And there's like kind of no off-ramp, it seems like.” [17:57]
Strait of HormuzIran conflictoil disruptionglobal impactUS economy
Adventures in Remote Viewing·made 4/27/2026 Source
Coordinated attacks on refineries19:09
Activelow confidence EnergyMilitaryDisasters

Coordinated attacks on refineries

Apr 2026 - Open· Global

The host notes that at least 50 refineries have been attacked globally, including in Gulf states, Russia, and even Texas. He suggests this may be a coordinated attack, though he hesitates to attribute it to world leaders. This implies a widespread campaign targeting energy infrastructure.

“I think at least 50 now. And the Gulf states and different countries and Russia. Even here in Texas, apparently, there is... there's just so many right now and it's almost like a coordinated attack.” [19:09]
refinery attackscoordinatedGulf statesRussiaTexasoil infrastructure
Adventures in Remote Viewing·made 4/27/2026 Source
Disruption of global resource flow17:47
Activemedium confidence EnergyFinancePolitics

Disruption of global resource flow

Apr 2026 - Open· Global

The host emphasizes that most of the world relies on resources from the Strait of Hormuz area, not just oil but many other resources. The conflict will therefore affect the mass populous worldwide, implying supply chain disruptions, economic strain, and potential energy crises.

“Most of the world is reliant not only on oil coming from this area, but many other kinds of resources. So, mass populous.” [17:47]
resource disruptionglobal supply chainStrait of Hormuzeconomic impact
Adventures in Remote Viewing·made 4/27/2026 Source
Staged events and media manipulation6:10
Activelow confidence NewsPolitics

Staged events and media manipulation

Since Apr 2026

During David's remote viewing session, he perceives staged events, multiple editing, and problematic editing software related to espionage. He also draws a danger zone with multiple witnesses and a warning sign. This suggests that some aspects of the conflict may be fabricated or manipulated for media purposes.

“Filmed on a sound stage. Staged events, multiple editing. Problematic. Editing software problematic espionage.” [6:10]
staged eventsmedia manipulationespionagepropaganda
Adventures in Remote Viewing·made 4/27/2026 Source
Underground bunkers and elite survival30:20
Activelow confidence ScienceTechnology

Underground bunkers and elite survival

Since Apr 2026

Patricia's session perceives underground structures, manufacturing, melting, blending, and illegal human activity. The material helps capture oxygen and extract CO2, enabling life underneath. The host interprets this as elites planning underground bunkers, implying a prediction about elite survival preparations.

“Building like underneath autonomous, creating autonomous life underneath. The material softening when the people to succeed in this life underneath. This material helps to capture oxygen, extracts CO2, so life is possible.” [30:20]
underground bunkerselite survivalautonomous lifeCO2 extraction
Adventures in Remote Viewing·made 4/27/2026 Source
Bitcoin post-quantum cryptography adoption within 5-10 years2:00
Activemedium confidence TechnologyCrypto

Bitcoin post-quantum cryptography adoption within 5-10 years

Jan 2026 - Jan 2036

Riccardo predicts that Bitcoin will need to adopt post-quantum cryptography within the next 5 to 10 years to remain secure. He discusses two possible paths: a small chance that meaningful privacy (like confidential transactions) is added alongside the quantum upgrade, but more likely the upgrade will be narrow (transaction signing and mining). He also notes that a layered privacy solution on Bitcoin, with a permanent settlement layer, may emerge in that timeframe.

“that is potentially where we land in in the next 5 to 10 years in terms of Bitcoin having meaningful privacy.” [2:00]
Bitcoinpost-quantum cryptographyprivacylayerslightning
Future Forecasting Group·made 4/25/2026 Source
Quantum computers 10-15 years away from breaking Bitcoin24:30
Activemedium confidence TechnologyScience

Quantum computers 10-15 years away from breaking Bitcoin

Jan 2026 - Jan 2041

Riccardo states that experts he is close to (researchers at University of Eindhoven) believe quantum computers capable of breaking Bitcoin's cryptography are still 10 to 15 years away. He notes that despite new papers, the timeline has not narrowed meaningfully. He also highlights the chicken-and-egg problem of testing post-quantum cryptography without a working quantum computer.

“a lot of them hold the view that we are um 10 to 15 years away.” [24:30]
quantum computingBitcoinpost-quantum cryptographysecurity
Future Forecasting Group·made 4/25/2026 Source
Massive growth of stablecoin usage by AI agents51:00
Activehigh confidence TechnologyFinanceCrypto

Massive growth of stablecoin usage by AI agents

Jan 2026 - Open· Global South (Vietnam, Thailand, Pakistan, India)

Riccardo predicts a 'Cambrian explosion' of stablecoin use driven by AI agents trained on human data. He observes that in the global south, people default to using Tether on TRON via Binance. AI agents, trained on forums with such recommendations, will replicate these choices and transact at unprecedented speed and volume, outpacing human transactions. He believes the world is entirely unprepared for this.

“there's going to be a lot of AI-powered agents that are going to make similar decisions... that explosion of stable coins is something we as a species are entirely unprepared for.” [51:00]
stablecoinsAI agentsTetherTRONglobal south
Future Forecasting Group·made 4/25/2026 Source
Regulators will face growing challenge from privacy-enhancing technologies7:45
Activemedium confidence PoliticsTechnology

Regulators will face growing challenge from privacy-enhancing technologies

Jan 2026 - Open· Global

Riccardo predicts that regulators will increasingly struggle to maintain surveillance capabilities as privacy technologies (like privacy coins and encryption) gain adoption. He compares it to parents losing access to their child's room. He notes that laws like GDPR and California Privacy Act are examples of pushback, and expects more such laws as people wake up to privacy as a human right.

“I'm hoping that there will be more because privacy is a human right. We've overcorrected... and now it's time to just pull that back a bit.” [7:45]
regulationprivacysurveillanceGDPRCalifornia Privacy Act
Future Forecasting Group·made 4/25/2026 Source
CBDCs will incorporate meaningful privacy features11:00
Activemedium confidence FinanceTechnologyPolitics

CBDCs will incorporate meaningful privacy features

Jan 2026 - Open· Global

Riccardo predicts that central bank digital currencies (CBDCs) that gain meaningful traction will include meaningful privacy protections, largely to satisfy corporate customers who need to protect trade secrets and transaction details from competitors. He notes that many CBDC proposals already have more privacy initiatives than most blockchains, though the central bank retains oversight.

“I'm hoping that the first ones that are issued that actually gain some meaningful traction are going to be ones that have meaningful privacy.” [11:00]
CBDCprivacycentral bankcorporationsdigital currency
Future Forecasting Group·made 4/25/2026 Source
Chaos will continue for several more years3:54
Activemedium confidence NewsPoliticsEnvironment

Chaos will continue for several more years

Apr 2026 - Open

Regina Meredith predicts that the current period of chaos and collapse will persist for several more years, and that the intensity will increase. She states that if people feel overwhelmed now, it will be worse in the future. This prediction is based on her long-term observation of societal and spiritual trends.

“Well, that chaos is going to go on for quite a few more years. This is the beginning. So, if you're feeling overwhelmed right now, imagine what it's going to be like a few years down the road.” [3:54]
chaoscollapsefuturesocietyspiritual
Elizabeth April·made 4/24/2026 Source
Increase in young people dying from disease and suicide37:00
Activelow confidence HealthNews

Increase in young people dying from disease and suicide

Since Apr 2026

Regina Meredith states that due to the intense energetic pressures of the current times—specifically from the 'rug pull' and failure to adapt—there is an increase in unnatural deaths among young people, including from diseases and suicides. She suggests this is not part of the normal life flow but a result of the spiritual and societal challenges.

“And I agree with you 100% and I also understand that the rug is going to be pulled out and we're seeing a lot of young people even dying. Diseases, suicides and so forth. Things that are not natural to the normal flow of life because of that and older people of course.” [37:00]
young peopledeathdiseasesuicidespiritual crisis
Elizabeth April·made 4/24/2026 Source
Higher field of consciousness for new generations20:51
Activelow confidence ScienceWoowoo

Higher field of consciousness for new generations

Since Apr 2026

Regina Meredith predicts that Gen Z and the Alpha generation are being born into a higher frequency field, which opens their natural abilities to understand spiritual concepts and manifest more easily. She suggests that this is a natural evolutionary step, where 'wishing' will be more powerful due to the elevated consciousness environment.

“We're going to come in like that when we reincarnate because the window's open, the frequencies are high, the beings coming in actually are coming into a higher field of consciousness already and that's opening their abilities to tap into the things I'm talking about, to understand these things natively. So, they can just wish and it's their command, you know? That's where we're headed.” [20:51]
generationconsciousnessevolutionmanifestationfrequency
Elizabeth April·made 4/24/2026 Source
Bitcoin price will reach $200,000 to $1,000,0004:10
Activemedium confidence FinanceCrypto

Bitcoin price will reach $200,000 to $1,000,000

Since Apr 2026

Steve Qualgare predicts that Bitcoin's price will rise significantly, reaching between $200,000 and $1,000,000. He frames Bitcoin as a store of value and treasury asset with fixed supply, suggesting that increasing scarcity (less than 1 million BTC left to mine as of April 2026) will drive price appreciation. He mentions that Bitcoin holders will earn interest from staking at those price levels.

“When Bitcoin goes to 200,000, to 250,000, to a half a million, to a million, at that point, those of us with Bitcoin will just have it staked and we will earn interest on just owning it.” [4:10]
Bitcoinprice predictionstore of valuescarcitystaking
Future Forecasting Group·made 4/23/2026 Source
Bitcoin adoption as a mainstream treasury asset continues2:57
Activelow confidence FinanceCrypto

Bitcoin adoption as a mainstream treasury asset continues

Since Apr 2026

The speaker asserts that Bitcoin has transitioned from a fringe financial concept to a mainstream treasury asset and digital store of value. He cites BlackRock as the third largest holder of Bitcoin, indicating institutional adoption. This is a predictive claim about the ongoing recognition of Bitcoin as a legitimate asset class.

“Bitcoin is a fixed supply. It is a treasury asset. Back in the day when it first came online, it was an idea. It was a fringe financial concept. Now it's mainstream. Now it is acknowledged as a treasury asset.” [2:57]
Bitcointreasury assetmainstream adoptionBlackRock
Future Forecasting Group·made 4/23/2026 Source
AI Will Automate Repetitive Hotel Tasks, Not Replace All Staff
Activemedium confidence Technology

AI Will Automate Repetitive Hotel Tasks, Not Replace All Staff

Since Apr 2026· United States

In this interview, Jonathan Lay, CEO of Q Concierge, predicts that AI in hospitality will focus on automating repetitive, low-value tasks such as phone answering and back-office services (marketing, procurement, event requests), rather than replacing all human labor. He argues that human staff will remain essential for high-touch services like luxury concierge and complaint resolution. The prediction is based on current labor shortages (69% of US hotels can't fill roles) and the need for human oversight to maintain trust and guest experience.

“We're not really here to replace all the labors. We want to take care of the repetitive task that a human doesn't want to do in the first place.” [0:00]
AIhospitalityautomationlaborhotelsQ Concierge
Future Forecasting Group·made 4/23/2026 Source
AI Adoption in Legacy Industries Will Be Slower Than Silicon Valley Expects
Activemedium confidence Technology

AI Adoption in Legacy Industries Will Be Slower Than Silicon Valley Expects

Since Apr 2026

Jonathan Lay predicts that automation and AI will progress much slower in legacy industries like hospitality than tech insiders and media suggest. He points out that many traditional enterprises are still experimenting with AI, with low ROI, and that physical-world robotics (world models) are far harder than language models. This implies a multi-year, gradual integration rather than rapid disruption.

“So I think the automation AI itself will progress, but it will be progressing way slower for a lot of those legacy industries than, you know, Insider and Silicon Valley people think.” [0:00]
AIadoptionlegacy industriesautomationhospitality
Future Forecasting Group·made 4/23/2026 Source
AI Voice Agents Will Handle 70% of Repetitive Hotel Tasks
Activemedium confidence Technology

AI Voice Agents Will Handle 70% of Repetitive Hotel Tasks

Since Apr 2026· United States

The CEO of Q Concierge states that their goal is to automate 70% of all repetitive human labor in hotels, including phone answering, back-office services like marketing and procurement, and event request processing. This is based on current statistics showing 40% of hotel calls are abandoned and significant revenue loss per property. The prediction implies a major shift in hotel operations over the coming years.

“We want to automate that like 70% of all repetitive human labor and really get the hoteliers and their staff who are passionate about, you know, customer experience and guest experiences for them to go in.” [0:00]
AIautomationhotelslaborvoice agents
Future Forecasting Group·made 4/23/2026 Source
AI Democratizes Luxury Travel for All Hotel Tiers
Activemedium confidence Technology

AI Democratizes Luxury Travel for All Hotel Tiers

Since Apr 2026

Jonathan Lay predicts that AI concierges will democratize luxury travel, allowing budget and mid-tier hotels to offer personalized services previously reserved for five-star properties. By automating repetitive tasks and using AI to handle guest requests, hotels of all levels can provide high-touch experiences, making luxury more accessible.

“We think about it as, you know, really democratizing luxury travel. If you think about, you know, uh how the billionaires are doing or the millionaires where they have uh specific concierges. ... And we want to do that for every tier of hotels, for everyone.” [0:00]
AIluxurydemocratizationhospitalityconcierge
Future Forecasting Group·made 4/23/2026 Source
AI Will Not Achieve 100% Accuracy; Human Guardrails Remain Necessary
Activehigh confidence Technology

AI Will Not Achieve 100% Accuracy; Human Guardrails Remain Necessary

Since Apr 2026

The interview emphasizes that no AI system can be 100% accurate or hallucination-free. Lay predicts that even the best AI voice agents will require human oversight for high-stakes transactions (e.g., bookings over $15,000) and for handling frustrated customers. The prediction is that human-in-the-loop will remain essential for trust and error correction.

“There's no 100% accuracy. If anybody's claiming that like their AI is not hallucinating, they're lying.” [0:00]
AIaccuracyhallucinationhuman oversighthospitality
Future Forecasting Group·made 4/23/2026 Source
General AI Chatbots Cannot Replace Vertical-Specific Integrated Solutions
Activehigh confidence Technology

General AI Chatbots Cannot Replace Vertical-Specific Integrated Solutions

Since Apr 2026

Lay predicts that generic AI chatbots (like OpenAI or Anthropic) will not be sufficient for complex industry verticals like hospitality. Successful AI deployment requires deep integration with property management systems, telephony, and domain-specific workflows. Big AI companies may eventually enter these spaces but will need significant time and resources to do so.

“If you look at Anthropic or Open AI, they're general chatbots, right? They can do some things for you but to make a booking and actually integrate with a hotel's property management system ... that's all proprietary needs integration.” [0:00]
AIintegrationverticalhospitalitychatbots
Future Forecasting Group·made 4/23/2026 Source
AI-Assisted Trading by Retail Investors Will Not Outperform Quant Funds
Activemedium confidence FinanceTechnology

AI-Assisted Trading by Retail Investors Will Not Outperform Quant Funds

Since Apr 2026

Lay predicts that retail investors using AI agents for trading will not gain an edge over established quant funds like Citadel or Jane Street, which have been using proprietary AI and low-latency infrastructure for years. He argues that market correlation may remain similar, and retail AI agents will struggle to compete.

“I don't think it's a good idea, right? Like you're competing still with all those market making companies, those big stock traders in general and they're going to have their own AI and it's going to be better yours.” [0:00]
AItradingretail investorsquant fundsarbitrage
Future Forecasting Group·made 4/23/2026 Source
AI Will Not Cause Mass Unemployment; Humans Will Pivot to New Roles
Activemedium confidence Technology

AI Will Not Cause Mass Unemployment; Humans Will Pivot to New Roles

Since Apr 2026

Lay and the host agree that historical patterns show humans adapt to technological change. While AI may reduce the number of workers needed in certain repetitive tasks, new roles will emerge. The prediction is that AI will augment productivity and increase GDP rather than eliminate jobs entirely.

“The jobs are not going away. ... You might need fewer people, but the good people that are in the industry will stay.” [0:00]
AIemploymentautomationlaborproductivity
Future Forecasting Group·made 4/23/2026 Source
AI Will Democratize Access to Medical Knowledge and Basic Healthcare
Activelow confidence HealthTechnology

AI Will Democratize Access to Medical Knowledge and Basic Healthcare

Since Apr 2026

The interview discusses how AI is already enabling people to get medical advice and information, reducing barriers to healthcare knowledge. Lay predicts that AI will continue to democratize access to medical services, especially for those without easy access to doctors.

“AI is definitely democratizing in a way where I think internet is democratizing in terms of having the even playground is in terms of education and starting point.” [0:00]
AIhealthcaredemocratizationmedicalaccess
Future Forecasting Group·made 4/23/2026 Source
Autonomous Robots in Hotels and Homes Will Take Longer Than Expected34:08
Activemedium confidence Technology

Autonomous Robots in Hotels and Homes Will Take Longer Than Expected

Since Apr 2026

Lay predicts that physical robots capable of doing chores in hotels or homes will not be widespread within 3–5 years, contradicting optimistic forecasts. He cites the difficulty of world models and the gap between language AI and physical robotics.

“Do you really think in like 3 or 5 years that they can do the chores for you? It can do everything for you and without a human it can, you know, you know, do the stuff for you? ... I think the automation AI itself will progress, but it will be progressing way slower.” [34:08]
AIrobotsautomationhospitalitytimeline
Future Forecasting Group·made 4/23/2026 Source
Canton Network will handle $100 trillion in value flow3:10
Activemedium confidence CryptoFinanceTechnology

Canton Network will handle $100 trillion in value flow

Since Apr 2026

This is a specific and ambitious prediction about the future role of the Canton Network in the global financial system. The speaker asserts that a massive amount of monetary energy—specifically $100 trillion—will eventually flow through the Canton Network. This implies that the network will become a dominant infrastructure for value transfer, likely surpassing traditional systems. The prediction is made with high confidence and is framed as an inevitable outcome based on an underlying energetic current of money.

“And I think 100 trillion of it is going to flow through the Canton network eventually.” [3:10]
Canton Network$100 trillionvalue flowcryptofinance
Future Forecasting Group·made 4/23/2026 Source
AI will cause widespread job losses39:40
Activemedium confidence TechnologyPoliticsNews

AI will cause widespread job losses

Since Apr 2026

The speaker predicts that artificial intelligence will lead to significant job displacement, although new roles will emerge for those who adapt. This is presented as a near-term shift, with accelerating changes in the coming years. The prediction is general but emphatically stated, with the speaker noting that many people will lose their jobs, but there will also be opportunities for those who lean into AI.

“A lot of you are going to lose your jobs. They've been predicting that. There's a lot of jobs that are going to going to come around if you learn how to lean into them,” [39:40]
AIjob lossautomationworkforcedisplacement
Future Forecasting Group·made 4/23/2026 Source
AI tax audits will be implemented40:04
Activemedium confidence PoliticsTechnologyFinance

AI tax audits will be implemented

Since Apr 2026

The speaker predicts that governments will deploy artificial intelligence to conduct tax audits, representing a major change in how taxation is enforced. This is part of a broader forecast of rapid societal transformation driven by AI and other technologies. The prediction is specific and presented as imminent.

“You're going to have AI tax audits.” [40:04]
AItax auditsgovernmentenforcementtechnology
Future Forecasting Group·made 4/23/2026 Source
Data centers in space by Elon Musk40:09
Activelow confidence TechnologySpaceScience

Data centers in space by Elon Musk

Since Apr 2026· space

The speaker refers to Elon Musk's ambition to build data centers in space, treating it as a real and upcoming development. This implies a future where space-based infrastructure supports computing and AI processing, with significant implications for technology and energy use.

“We're talking about Musk is over here wanting to make data centers in space.” [40:09]
Elon Muskdata centersspaceinfrastructureAI
Future Forecasting Group·made 4/23/2026 Source
College system will collapse due to AI46:10
Activemedium confidence TechnologyPoliticsNews

College system will collapse due to AI

Since Apr 2026

The speaker predicts that traditional colleges will largely disappear in the future because AI will provide personalized, accessible education, making the current model obsolete. This is presented as a drastic transformation within a few years, with implications for student debt and the value of degrees.

“That's going to go away because there's not going to be all these colleges in the future.” [46:10]
collegeAIeducationdisruptionstudent debt
Future Forecasting Group·made 4/23/2026 Source
Price of Redstone will rise to $0.31-$0.339:15
Activemedium confidence CryptoFinance

Price of Redstone will rise to $0.31-$0.33

Since Apr 2026

Based on Fibonacci analysis, the speaker predicts that the Redstone token will trade between $0.31 and $0.33 in the near future, representing a potential 100%+ gain from its current price around $0.13. The prediction is presented as a technical analysis forecast for traders, with the caveat that it's not guaranteed but likely.

“there's a good chance in the near future Red will be between 31 cents or between uh yeah, 31 cents and 33 cents.” [9:15]
Redstoneprice prediction$0.31$0.33Fibonaccicrypto trading
Future Forecasting Group·made 4/23/2026 Source
Crypto market will see a major breakout18:03
Activelow confidence CryptoFinance

Crypto market will see a major breakout

Since Apr 2026

The speaker, Javier, expresses a belief that the crypto market will experience a significant upward move ('the dam is going to open up') within months to a year. This is a general bullish prediction about the entire crypto market, based on a sense of accumulated pressure and eventual release.

“I know the dam is going to open up one of these days even months a year from now it don't matter” [18:03]
cryptobull runmarket breakoutinvestmenthopium
Future Forecasting Group·made 4/23/2026 Source
Transition to a new monetary system via crypto34:45
Activemedium confidence FinancePoliticsNews

Transition to a new monetary system via crypto

Since Apr 2026

The group repeatedly asserts that the global financial system is transitioning from fiat currency to a crypto-based system. This is presented as an inevitable evolution, with crypto becoming the backbone of the new financial order. The prediction is broad and long-term.

“we are in the transition to a new monetary system.” [34:45]
monetary transitionnew financial systemcryptofiatevolution
Future Forecasting Group·made 4/23/2026 Source
AI-driven K-shaped economic acceleration0:39
Activemedium confidence Technology

AI-driven K-shaped economic acceleration

Since Apr 2026

The speaker predicts that the K-shaped economy, where a small percentage of people thrive while the majority falls behind, will be turbocharged by AI. The gap between those on the right side of this shift and those who aren't will not close but will accelerate moving forward. Most people won't realize which side they are on until it is too late to change course.

“The K-shaped economy where a small percentage of people thrive while the majority falls behind is being turbocharged by AI. The gap between people on the right side of this shift and those who aren't is not going to close. It's only going to accelerate moving forward.” [0:39]
K-shaped economyAIinequalityaccelerationeconomic gap
Future Forecasting Group·made 4/22/2026 Source
AI restructuring economy faster than previous tech cycles1:27
Activehigh confidence Technology

AI restructuring economy faster than previous tech cycles

Apr 2026 - Apr 2029

The speaker predicts that the AI-driven economic restructuring will occur much faster than previous technological shifts. While the internet restructured the economy in the late 1990s and smartphones in the 2010s, the AI restructuring will take only two to three years instead of ten. The window to position oneself correctly is narrow.

“What took 10 years in previous cycles is going to take just two to three years this time, possibly even less.” [1:27]
AI restructuringspeedeconomic cyclepositioning
Future Forecasting Group·made 4/22/2026 Source
Decentralized AI compute infrastructure as asymmetric opportunity7:12
Activemedium confidence CryptoTechnologyFinance

Decentralized AI compute infrastructure as asymmetric opportunity

Apr 2026 - Open

The speaker predicts that specific crypto assets at the intersection of AI and blockchain, particularly decentralized compute networks and infrastructure layers, represent some of the most compelling asymmetric opportunities in the crypto market today. This is analogous to early investments in internet infrastructure that became extremely valuable before mainstream adoption. The mainstream has not yet caught on, so there is still a window of opportunity.

“Specific crypto assets sit at this intersection. We're talking about AI coins, decentralized compute networks, and infrastructure layers. These represent some of the most compelling asymmetric opportunities we've seen in the crypto market today.” [7:12]
AI coinsdecentralized computeblockchainasymmetric opportunityinfrastructure
Future Forecasting Group·made 4/22/2026 Source
Structural Dollar Debasement in the Next Decade3:46
Activemedium confidence FinancePolitics

Structural Dollar Debasement in the Next Decade

Apr 2026 - Apr 2036

The video asserts that holding the majority of wealth in dollar-denominated assets (401ks, savings accounts, bonds, most US stocks) exposes individuals to the single biggest systemic risk of the next decade. This risk is not just market volatility but structural dollar debasement due to currency weaponization, sanctions, and the BRICS coalition building infrastructure to operate outside the dollar system. The prediction implies that the dollar will lose significant value over the next 10 years, requiring different solutions than typical market downturns.

“you're exposed to the single biggest systemic risk of the next decade. It's not just market volatility we're talking about here. We're talking about structural dollar debasement.” [3:46]
dollar debasementsystemic riskcurrencyBRICSfinancial system
Future Forecasting Group·made 4/22/2026 Source
BRICS Infrastructure for Dollar Alternative1:44
Activehigh confidence FinancePoliticsEnergy

BRICS Infrastructure for Dollar Alternative

Since Apr 2026

The video claims that countries locked in the dollar system for 50 years are quietly building the infrastructure to operate outside of it, citing this as stated public policy of the BRICS coalition. Central banks are buying gold at the fastest rate in recorded history, and the yuan is being used to settle oil contracts that were dollar-denominated since the 1970s. This suggests a gradual but significant shift away from dollar hegemony in international trade and reserves.

“Countries that have been locked in the dollar system for 50 years are quietly building the infrastructure to operate outside of it.” [1:44]
BRICSde-dollarizationgoldyuanoil contracts
Future Forecasting Group·made 4/22/2026 Source
Assets Repricing During Dollar Weakness4:09
Activemedium confidence Finance

Assets Repricing During Dollar Weakness

Since Apr 2026

The video warns that by the time the dollar's weakness is confirmed on mainstream news, the entry point for alternative assets will be gone. It implies that assets positioned as alternatives (like gold or Bitcoin) will reprice significantly upward as the dollar declines. Those who wait for confirmation will miss the opportunity, a pattern observed in previous financial transitions like 2008.

“by the time the dollar's weakness is confirmed, the entry point you could have had today is gone.” [4:09]
dollar weaknessasset repricingentry pointalternative assetsmarket timing
Future Forecasting Group·made 4/22/2026 Source
Gold and Bitcoin Outperformance During Economic Uncertainty3:09
Activehigh confidence FinanceCrypto

Gold and Bitcoin Outperformance During Economic Uncertainty

Since Apr 2026

The video claims that gold performs well during economic uncertainty and Bitcoin is a high upside asymmetric asset that has historically outperformed every other asset class across its lifetime. It advises having exposure to both, especially in the current environment, as a hedge against the dollar system's restructuring. Zero exposure to either is described as the actual risk most people ignore.

“Gold is a 5,000-year-old store of value that tends to perform well during economic uncertainty... Bitcoin is a high upside asymmetric asset that has historically outperformed every other asset class across its lifetime.” [3:09]
goldBitcoineconomic uncertaintystore of valueasymmetric asset
Future Forecasting Group·made 4/22/2026 Source
More missing scientists will be discovered1:04
Activelow confidence NewsMilitaryWoowoo

More missing scientists will be discovered

Since Apr 2026

The speaker, James Vitale, intends to remote view the case of missing UAP scientists, implying that further scrutiny will reveal more missing or murdered individuals connected to UAP research. He references General McCasland and mentions that media has picked up on the trend, suggesting the phenomenon may be ongoing and broader than currently known. The prediction is that through his ongoing remote viewing sessions, additional details or victims will come to light, potentially confirming a pattern of suppression.

“I will take a look at this and this is a kind of a lesson in remote viewing.” [1:04]
missing scientistsUAPremote viewingGeneral McCaslanddisclosure
Psychic Recon - James Vitale·made 4/21/2026 Source
Remote viewing method limitations will be exposed0:02
Activemedium confidence ScienceParanormal

Remote viewing method limitations will be exposed

Since Apr 2026

James Vitale claims that many modern remote viewers fail to properly interpret intuitive data because they lack awareness of the psychological mechanisms involved in information transfer from cosmic consciousness to conscious awareness. This implies that current remote viewing practices are often inaccurate or limited, and without proper understanding, they remain mere 'parlor tricks.' The prediction suggests a need for improvement in training or methodology to achieve practical, reliable results for public applications.

“They just don't seem to be aware of some of the psychological mechanisms of how that information matriculates down” [0:02]
remote viewingpsychological mechanismsinterpretationmodern viewersaccuracy
Psychic Recon - James Vitale·made 4/21/2026 Source
Historic Moon Landings Actually Occurred but with Cover-ups0:29
Activelow confidence ScienceSpacePoliticsParanormal

Historic Moon Landings Actually Occurred but with Cover-ups

Since Apr 2026

The remote viewer claims that both the 1969 Apollo moon landing and the Artemis 2 mission actually happened, contrary to conspiracy theories. However, she asserts that the official narratives involve significant cover-ups: the 1969 landing included an encounter with extraterrestrials that forced astronauts to leave abruptly, leading NASA to fabricate footage to conceal the incident. For Artemis 2, the mission did orbit the Moon, but many NASA images released to the public are fake, serving agendas like space domination, public appeasement, distraction, and preparation for future cosmic disclosure. The prediction implies that the truth is a mixture of real achievement and deliberate misinformation.

“What I found was that, yeah, we actually left the planet and we went there. However, there were massive cover-ups on both ends.” [0:29]
moon landingArtemis 2cover-upextraterrestrialsNASAfake footage
Elizabeth April·made 4/20/2026 Source
Artemis 2 Was Used for Space Domination and Disclosure Agenda1:24
Activelow confidence PoliticsSpaceParanormal

Artemis 2 Was Used for Space Domination and Disclosure Agenda

Since Apr 2026

The remote viewer predicts that the Artemis 2 mission was not solely for exploration but had hidden purposes including establishing space domination, appeasing the public over the long gap since the last moon landing, creating distraction, and tying into later cosmic disclosure about extraterrestrial life. The mission is seen as part of a broader agenda to gradually reveal the truth about extraterrestrials, suggesting that future disclosure will be linked to returning to the Moon.

“It almost felt like us going back to the moon in a sense is going to tie in to later cosmic disclosure.” [1:24]
Artemis 2space dominationdisclosureagendaextraterrestrials
Elizabeth April·made 4/20/2026 Source
Artemis 2 Orbited Moon With Permission From Extraterrestrials16:59
Activemedium confidence SpacePoliticsParanormal

Artemis 2 Orbited Moon With Permission From Extraterrestrials

Nov 2025 - Open· Moon

According to the speaker's remote viewing, the Artemis 2 mission did orbit the moon as reported, but most images from the mission were doctored, especially those of the dark side of the moon, which was intentionally obscured due to significant extraterrestrial activity. The mission was carried out with prior permission from extraterrestrial intelligence, unlike the 1969 landing. The speaker claims the mission aimed to control the space narrative, serve as a distraction from more important events on Earth, and potentially plant seeds for future disclosure of extraterrestrial presence.

“They did indeed orbit the moon. They did. They left the planet. There was astronauts inside. They went around the moon.” [16:59]
Artemis 2moonextraterrestrialNASAremote viewingdisclosure
Elizabeth April·made 4/20/2026 Source
1969 Moon Landing Partially Real and Staged6:46
Activemedium confidence SpaceParanormalPolitics

1969 Moon Landing Partially Real and Staged

Jul 1969 - Open· Moon

The speaker remote-viewed the 1969 moon landing and claims it did happen, but the astronauts were confronted by extraterrestrial presence shortly after landing. The ETs denied them permission to be there, leading to a rushed departure. The speaker states that the astronauts had been briefed about ETs and were directed to make contact for a trade deal. To cover up the ET encounter, most footage shown to the public was staged. The event was both real (the actual landing) and fake (the broadcasted imagery).

“The 1969 moon landing actually happened... but they were confronted by ET presence.” [6:46]
moon landing1969extraterrestrialstagedNASAcover-up
Elizabeth April·made 4/20/2026 Source
Moon Is a Hollow Artificial Satellite With Bases on Dark Side2:27
Activelow confidence SpaceParanormalScience

Moon Is a Hollow Artificial Satellite With Bases on Dark Side

Since Apr 2026· Moon

The speaker claims the moon is not a natural rock but a hollow, metal structure. She describes remote-viewing the moon's interior in 2011 during a meeting with the Galactic Federation of Light. The dark side of the moon is said to contain numerous bases, structures, and communication hubs. The moon was originally placed as a weapon to dull humanity's frequencies but was later taken over by the Galactic Federation and now serves as a meeting place.

“The moon on the inside was completely hollow and it seemed like it was made of metal.” [2:27]
moonhollowartificial satelliteextraterrestrial basesGalactic Federation
Elizabeth April·made 4/20/2026 Source
SpaceX Attempted to Uncover NASA Cover-Up But Was Blocked by Extraterrestrials17:02
Activelow confidence SpacePoliticsTechnologyParanormal

SpaceX Attempted to Uncover NASA Cover-Up But Was Blocked by Extraterrestrials

Since Apr 2026

The speaker remote-viewed that SpaceX, led by Elon Musk, initially tried to uncover the truth about NASA's cover-ups regarding extraterrestrial presence. However, SpaceX discovered larger forces at play and was subsequently limited by rules and regulations imposed by extraterrestrial entities and the Galactic Federation. The speaker suggests there are things humanity is not yet allowed to know, and that disclosure is gradually happening as contracts are being lifted.

“SpaceX tried to uncover what NASA was covering up and they realized that there were bigger forces at play.” [17:02]
SpaceXElon MuskNASAcover-upextraterrestrialdisclosure
Elizabeth April·made 4/20/2026 Source
Most NASA Footage Is Not Live Due to Extraterrestrial Cover-Up19:19
Activemedium confidence SpacePoliticsParanormal

Most NASA Footage Is Not Live Due to Extraterrestrial Cover-Up

Since Apr 2026

The speaker asserts that NASA has never provided truly live footage from space missions beyond possibly the initial launch. The reason for this is the risk of inadvertently revealing extraterrestrial presence, which would undermine their cover-up. NASA's biggest secret, according to the speaker, is that extraterrestrials are real and have been interacting with humanity for a long time.

“I don't think NASA has ever had live footage... the reason why they don't do any live footage is because extraterrestrial presence could be involved.” [19:19]
NASAlive footagecover-upextraterrestrialdisclosure
Elizabeth April·made 4/20/2026 Source
Oil Price Spike from Strait of Hormuz Threat2:10
Activehigh confidence EnergyMilitaryFinance

Oil Price Spike from Strait of Hormuz Threat

Since Apr 2026· Strait of Hormuz

The video warns that any significant escalation in the Iran-Israel conflict threatens the Strait of Hormuz, through which roughly 20% of the world's oil supply passes. This would cause energy prices to spike rapidly, and higher energy costs would then drive up prices across the economy, as seen in grocery bills. The prediction is based on the strategic importance of the strait and Iran's control over it.

“Any significant escalation that threatens that route will cause energy prices to spike rapidly.” [2:10]
oil price spikeStrait of HormuzIran conflictenergy pricessupply chain
Future Forecasting Group·made 4/20/2026 Source
Safe Haven Asset Rally (Gold, Swiss Franc, Bitcoin)2:31
Activemedium confidence FinanceCrypto

Safe Haven Asset Rally (Gold, Swiss Franc, Bitcoin)

Since Apr 2026

The video claims that a safe haven trade is already underway, with capital moving toward gold, the Swiss franc, and increasingly Bitcoin. It notes that Bitcoin has remained stable amid the conflict, suggesting it is benefiting from being outside the threatened US dollar system. The prediction is that these assets will continue to hold or increase in value as geopolitical risk rises, while traditional portfolios may decline.

“When geopolitical risk rises, capital has historically moved towards gold, towards the Swiss franc, and increasingly, it's starting to move towards Bitcoin.” [2:31]
safe havengoldBitcoinSwiss franccapital flows
Future Forecasting Group·made 4/20/2026 Source
US Dollar Purchasing Power Decline Due to Conflict3:14
Activemedium confidence FinancePolitics

US Dollar Purchasing Power Decline Due to Conflict

Since Apr 2026

The video predicts that a protracted Middle East conflict drawing US resources, increasing defense spending, and accelerating BRICS dedollarization will put meaningful downward pressure on the dollar's purchasing power over time. This is described as a slow-moving threat that will show up in rising grocery bills and reduced buying power. Those who act early on this trend are expected to benefit.

“A protracted Middle East conflict that draws US resources, increases defense spending, and accelerates the dedollarization push from the BRICS nations, puts meaningful pressure on the dollar purchasing power over time.” [3:14]
US dollarpurchasing powerdedollarizationBRICSinflation
Future Forecasting Group·made 4/20/2026 Source
Energy Sector Floor Under Oil Prices3:53
Activemedium confidence EnergyFinance

Energy Sector Floor Under Oil Prices

Since Apr 2026

The video states that conflict in the region creates a floor under oil prices, making energy sector equities, ETFs, or commodities exposures beneficial. It recommends getting exposure to energy as a strategic move, noting that the conflict supports higher oil prices for the foreseeable future.

“Conflict in the region creates a floor under oil prices.” [3:53]
oil floorenergy sectorconflictinvestment
Future Forecasting Group·made 4/20/2026 Source
Continued Gold Rally from Central Bank Buying4:10
Activemedium confidence Finance

Continued Gold Rally from Central Bank Buying

Since Apr 2026

The video claims that central bank gold buying over the previous two years was an early warning of the current conflict scenario, and that gold has already been moving higher. It suggests that it is not too late to get positioned in gold, implying further price increases as the conflict unfolds.

“Gold has already been moving. The central bank's buying that has been happening for the last 2 years was really an early warning of this exact scenario that we're faced with now.” [4:10]
goldcentral bank buyingsafe havenprice rally
Future Forecasting Group·made 4/20/2026 Source
Upcoming UAP disclosure will be insufficient5:08
Activemedium confidence PoliticsMilitary

Upcoming UAP disclosure will be insufficient

Jun 2026 - Aug 2026

The speaker predicts that the upcoming UAP disclosure expected in summer 2026 will be 'junk' and not move the world. He claims that announcements by President Trump about releasing documents are cover-ups, and that the military interacts daily with 'bad ETS' but will not reveal the full truth. The prediction suggests that official disclosure will be a controlled, limited release that maintains the status quo of secrecy.

“expect this so-called disclosure thing that's supposed to come up sometime this summer. Expect it to be junk.” [5:08]
disclosureUAPTrumpcover-upgovernment
Farsight·made 4/20/2026 Source
Good ETs are family and will help humanity39:48
Activelow confidence ParanormalWoowooPolitics

Good ETs are family and will help humanity

Since Apr 2026

The speaker claims that Farsight research suggests good extraterrestrials are 'family' to humanity, and that the human population was taken from them long ago. He predicts that this rescue effort has consumed thousands of years of preparation, implying that the good ETs will eventually free humanity from the control of bad ETs. The prediction is tied to the idea that the good ETs are driven by love, but the speaker acknowledges limits to their commitment.

“our research indicates that the good eats are family, our family, and that the human population was taken from them a very long time ago. And this rescue effort on the part of the Goodites has consumed thousands of years of preparation.” [39:48]
extraterrestrialsrescuegood ETshumanityfamily
Farsight·made 4/20/2026 Source
Humanity must actively participate in its own liberation44:04
Activelow confidence PoliticsParanormal

Humanity must actively participate in its own liberation

Since Apr 2026

The speaker predicts that if humanity does not make its own effort toward disclosure and freedom, the good ETs may be unable or unwilling to carry the entire burden of rescue. He warns that love, responsibility, and guilt all have limits, and that pushing those limits could lead to the good ETs retreating, leaving humanity enslaved by bad ETs. Therefore, human action (such as watching Farsight's content) is necessary for a successful outcome.

“The future of humanity does not depend only on whether we are helped. It depends on whether we are capable of understanding the nature of that help and meeting it halfway.” [44:04]
disclosurehumanityliberationgood ETsrescue
Farsight·made 4/20/2026 Source
Secret space program uses ET technology46:19
Activelow confidence MilitaryTechnologySpace

Secret space program uses ET technology

Since Apr 2026

The speaker asserts that the US government operates a secret space program using extraterrestrial technology, separate from public programs like SpaceX and the ISS. He mentions the X37B as a known craft, and claims there are three types of space exploration: public rockets, secret conventional spacecraft (X37B), and secret ET-tech craft. This implies that the government has hidden advanced capabilities that will eventually be revealed or used.

“they have the other spaceships, the ones that use ET Tech, and they keep those super secret as part of the secret space program.” [46:19]
secret space programX37BET technologymilitaryUFO
Farsight·made 4/20/2026 Source
Humanity could end up enslaved by bad ETs if not rescued44:40
Activelow confidence ParanormalPolitics

Humanity could end up enslaved by bad ETs if not rescued

Since Apr 2026

The speaker predicts a possible negative outcome where, if the good ETs push their limits and abandon the rescue effort, humanity will remain enslaved by bad extraterrestrials. This is presented as a warning and a consequence of not actively participating in disclosure and self-improvement.

“we would be alone as slaves and the bad ETS would remain our masters.” [44:40]
enslavementbad ETshumanityrescue failuredisclosure
Farsight·made 4/20/2026 Source
Upcoming UAP disclosure will be insufficient3:28
Activemedium confidence PoliticsParanormal

Upcoming UAP disclosure will be insufficient

Jun 2026 - Aug 2026

The speaker predicts that a so-called disclosure event regarding UFOs/UAPs, expected in summer 2026, will be 'junk' and not meaningful. He claims that any documents released by the government, including hints from Donald Trump, are part of a cover-up, not real transparency. The prediction is based on the speaker's view that the U.S. military interacts with 'bad ETs' and will not reveal the truth.

“So expect this so-called disclosure thing that's supposed to come up sometime this summer. Expect it to be junk.” [3:28]
UAP disclosuregovernment cover-upTrumpsummer 2026
Farsight·made 4/20/2026 Source
Good ETs will help humanity if humans meet them halfway55:15
Activemedium confidence Paranormal

Good ETs will help humanity if humans meet them halfway

Since Apr 2026

The speaker predicts that 'good ETs' are willing to help humanity escape from the control of 'bad ETs,' but only if humans actively participate in their own liberation through disclosure and self-awareness. The help is motivated by love, not responsibility or guilt, but love has limits. If humanity does not make an effort, the good ETs may retreat, leaving humans as slaves.

“The good ETs cannot help a population that makes no effort to help itself. Love alone cannot fix that.” [55:15]
good ETsbad ETsdisclosurehuman effortrescue
Farsight·made 4/20/2026 Source
Humanity faces enslavement if it fails to act57:00
Activemedium confidence Paranormal

Humanity faces enslavement if it fails to act

Since Apr 2026

The speaker warns that if humanity does not push for true disclosure and change, the 'bad ETs' will remain in control, and humans will be alone as slaves. This is a conditional prediction: if limits of love, responsibility, and guilt are exceeded by human inaction, the good ETs may abandon the rescue effort.

“And if we push those limits too far, we may find ourselves alone, which means without anyone to rescue us. And if that happens, we would be alone as slaves, and the bad ETs would remain our masters.” [57:00]
enslavementbad ETsabandonmentfuture of humanity
Farsight·made 4/20/2026 Source
AI Hiring Freeze and Job Market Slowdown10:24
Activemedium confidence TechnologyFinancePolitics

AI Hiring Freeze and Job Market Slowdown

Jan 2025 - Open

The speaker states that an AI-driven hiring freeze is already occurring, with companies waiting to see what they can do with fewer employees before hiring. This is causing a slowdown in the job market, though mass layoffs have not yet materialized. The prediction is that this hiring freeze will persist and eventually lead to significant job losses for lower performers, particularly in industries like customer care, programming, logistics, and food service, as AI solutions are being developed for those fields.

“the AI hiring freeze is very real and and companies are trying to see what they can do with less right now.” [10:24]
AIhiring freezejob marketlayoffsautomation
Future Forecasting Group·made 4/19/2026 Source
AI-Driven Job Loss in Customer Care and Programming20:51
Activemedium confidence TechnologyFinance

AI-Driven Job Loss in Customer Care and Programming

Since Apr 2026

The speaker predicts that AI will cause significant job losses in sectors that rely on large datasets, specifically calling out customer care and programming. The reasoning is that AI can automate many tasks in these fields, and the speaker notes that high-level engineering executives are already mourning the loss of their craft as AI code becomes superior and much faster. This will impact many workers in these industries over time.

“I'm nervous about it hitting the economy all at once, customer care, programming. Like there's so many things that people do with large data sets.” [20:51]
AIjob losscustomer careprogrammingautomation
Future Forecasting Group·made 4/19/2026 Source
Rise of AI Enablement and Transformation Agencies12:45
Activemedium confidence TechnologyFinance

Rise of AI Enablement and Transformation Agencies

Since Apr 2026

The speaker predicts that a fragmented industry of AI enablement firms will emerge, helping businesses undergo AI transitions. These agencies will be staffed by individuals trained in using various AI tools (LLMs, video generation, coding, etc.). Larger consultancies will also develop AI transformation departments. This represents a major opportunity for workers to reskill and enter a new industry that is less than 3 years old.

“they've got these agencies now that are like transformation agencies to help businesses undergo some of these AI transitions. And that's going to be a big I think fragmented industry” [12:45]
AItransformation agencyconsultingreskillingopportunity
Future Forecasting Group·made 4/19/2026 Source
Potential Mass Displacement of Workers Due to AI and Robotics32:48
Activelow confidence PoliticsTechnology

Potential Mass Displacement of Workers Due to AI and Robotics

Since Apr 2026

The speaker speculates that as AI and robotics (e.g., Optimus) replace manual labor in farming, logistics, shipping, and other sectors, the societal elite may no longer need the majority of the population for productivity. This could lead to a future where average people are not valued and might face population culling or neglect. The prediction is tied to concerns about birth rates and the conflicting signals from leaders who encourage more births while creating conditions that discourage family formation.

“once AI makes it so that way they don't need people to build um and to grow food and to run logistics and to man the ships and the airplanes and stuff, I think that they have like a small group of people that they want around them.” [32:48]
AIroboticspopulationUBIelitedisplacement
Future Forecasting Group·made 4/19/2026 Source
AI Equalizing Software Development Skills17:37
Activehigh confidence Technology

AI Equalizing Software Development Skills

Jan 2025 - Open

The speaker claims that currently, AI tools like Claude give the average user the same programming ability as 90% of software developers. This is a massive equalizer that reduces the value of traditional coding skills. The prediction implies that the demand for junior to mid-level software developers will drop dramatically as AI can generate high-quality code at 100,000 times the speed of a human.

“you have the exact same programming ability as 90% of software developers, I would say. And that is really an equalizer, massive equalizer.” [17:37]
AIcodingsoftware developmentequalizerjob displacement
Future Forecasting Group·made 4/19/2026 Source
Future of UBI and Societal Shift Due to AI31:53
Activelow confidence Politics

Future of UBI and Societal Shift Due to AI

Since Apr 2026

The speaker suggests that AI could free up human toil time, potentially making Universal Basic Income (UBI) a good idea. However, the speaker expresses worry that the ruling elite may not want to empower the average person, leading instead to a more controlling outcome. The prediction is that the most likely scenario is a form of mass social control or displacement rather than a beneficial UBI.

“I think actually unfortunately the most likely outcome is probably some type of um I don't know if the right way to put this is like a mass style off or calling or something along those lines.” [31:53]
AIUBIelitesocial controlfuture of work
Future Forecasting Group·made 4/19/2026 Source
Billionaire Space Escape as Earth Declines38:16
Activelow confidence SpacePoliticsEnvironment

Billionaire Space Escape as Earth Declines

Since Apr 2026

The speaker predicts that billionaires are actively ruining the planet and then trying to escape to space, but that they will not find a better local place than Earth. The prediction implies that efforts to colonize other planets will not succeed in providing a viable alternative for the wealthy, and that humanity should instead focus on sending its best into space, not its worst. This is a more philosophical prediction about space colonization outcomes.

“I do think that there's like this deep concern of of like billionaires to like get off the planet like that they're actively ruining. ... I don't think that they're going to find like a better local place than this.” [38:16]
billionairesspace colonizationEarthenvironmentescape
Future Forecasting Group·made 4/19/2026 Source
AI Automated Website Building for Solopreneurs6:59
Activemedium confidence TechnologyFinance

AI Automated Website Building for Solopreneurs

Since Apr 2026

The speaker predicts that AI will enable a new business model where automated websites guide users through launching their own websites using tools like Claude. This will lower the barrier to entry for solopreneurs, making it possible for one person to create functional, beautiful websites that previously cost $30k-$50k and took months. The prediction is that this will be a huge opportunity for entrepreneurs in the near term.

“I think I'm going to start a whole business model where I have an automated website that takes them through the process of launching their own website with with Claude cuz there is still that like that the adoption barrier” [6:59]
AIwebsite buildingsolopreneurautomationopportunity
Future Forecasting Group·made 4/19/2026 Source
BRICS payment system challenges dollar hegemony0:24
Activemedium confidence FinancePolitics

BRICS payment system challenges dollar hegemony

Since Apr 2026

The dollar's reserve status is being systematically challenged by the BRICS payment system, bilateral trade agreements bypassing SWIFT, and record central bank gold purchases. Although the system won't collapse tomorrow, the trajectory indicates a gradual erosion of US financial dominance.

“The dollar's reserve status... is being systematically challenged. Not theoretically challenged, practically challenged through the BRICS payment system, through bilateral trade agreements that bypass Swift, through central bank gold purchases that have reached record levels.” [0:24]
dollar reserve statusBRICSSWIFTcentral bank gold
Future Forecasting Group·made 4/17/2026 Source
Post-WWII geopolitical order collapsing1:53
Activemedium confidence PoliticsMilitary

Post-WWII geopolitical order collapsing

Since Apr 2026· Middle East, Eastern Europe, South China Sea

The post-World War II order, characterized by US military dominance, dollar-based trade, and Western-led institutions, is being contested simultaneously in the Middle East, Eastern Europe, and the South China Sea. These conflicts are symptoms of a single transition where the old order loses authority and a new one has not yet formed, creating a dangerous but opportunity-rich period.

“The post-World War II order... is being contested everywhere simultaneously. The Middle East, Eastern Europe, and the South China Sea, these aren't isolated conflicts. They're the symptoms of a single underlying dynamic.” [1:53]
geopolitical shiftUS dominancepost-WWII order
Future Forecasting Group·made 4/17/2026 Source
AI will create K-shaped economic split over next decade1:53
Activemedium confidence Technology

AI will create K-shaped economic split over next decade

Apr 2026 - Apr 2036

AI is restructuring the labor economy faster than previous technologies, affecting not just manual labor but also white-collar professional knowledge work. This will create a K-shaped split in the economy, which will be a defining social dynamic over the next decade.

“The jobs being restructured aren't just manual labor, they're white-collar, professional, knowledge-based work jobs. The K-shaped split this creates in the economy is going to be one of the defining social dynamics of the next decade.” [1:53]
AIlabor restructuringK-shaped recoverywhite-collar jobs
Future Forecasting Group·made 4/17/2026 Source
Institutional trust will continue to collapse globally3:02
Activemedium confidence Politics

Institutional trust will continue to collapse globally

Since Apr 2026

Trust in media, government, financial systems, and health authorities is at historic lows and continuing to fall globally. This collapse is measured consistently across major studies and forces people to develop their own frameworks for understanding reality without institutional guardrails.

“Trust in institutions... is at historic lows and continuing to fall. We're talking media, government, financial systems, health authorities. The collapse in institutional trust is not a fringed phenomenon.” [3:02]
institutional trustmedia distrustgovernment trustpublic opinion
Future Forecasting Group·made 4/17/2026 Source
Wealth managers will rapidly adopt collateralized lending against tokenized assets10:54
Activemedium confidence FinanceTechnology

Wealth managers will rapidly adopt collateralized lending against tokenized assets

Since Apr 2026

Bill Barhydt predicts that the wealth management space will move quickly into collateralized lending against tokenized assets, as it is a more tax-efficient way to realize gains for long-term holders. He argues that tokenization allows borrowing against assets like stocks, ETFs, and real estate, unlocking trillions in illiquid value. This shift will converge wealth management, asset management, and traditional banking.

“I predict that the wealth management space is going to move head fast into collateralized lending versus tokenized assets.” [10:54]
tokenizationcollateralized lendingwealth managementDeFiilliquid assets
Future Forecasting Group·made 4/16/2026 Source
Clarity Act will be passed to secure crypto regulations9:08
Activemedium confidence PoliticsFinance

Clarity Act will be passed to secure crypto regulations

Since Apr 2026· United States

Barhydt expects the Clarity Act to pass, creating a regulatory moat around digital assets so that policies cannot be reversed by future administrations. He emphasizes that the Act is urgently needed to provide clear operating rules for financial institutions, wealth managers, and exchanges, especially as tokenization expands.

“I think it's going to get passed.” [9:08]
Clarity ActregulationcryptoSECCFTC
Future Forecasting Group·made 4/16/2026 Source
Federal regulation will win over state regulation of prediction markets14:08
Activemedium confidence PoliticsFinance

Federal regulation will win over state regulation of prediction markets

Since Apr 2026· United States

Bill states that the federal government will prevail in the regulatory battle over prediction markets, arguing that federal law generally trumps state law and that having a patchwork of state regulations is untenable. He views this as a positive development for the crypto ecosystem.

“I think the feds are going to win on that one which is probably a good thing.” [14:08]
prediction marketsregulationfederalstatecrypto
Future Forecasting Group·made 4/16/2026 Source
Mortgage lenders will custody Bitcoin as collateral12:31
Activemedium confidence Finance

Mortgage lenders will custody Bitcoin as collateral

Since Apr 2026

Barhydt predicts that mortgage lenders and banks will increasingly want to custody Bitcoin and other crypto assets directly to use as collateral for loans, driven by client demand and guidance from Fannie Mae. This will be a significant institutional use case that trickles down to retail quickly.

“I think a lot of mortgage lenders in the banking world are now going to want to custody these assets themselves” [12:31]
mortgageBitcoincollateralcustodylending
Future Forecasting Group·made 4/16/2026 Source
Bitcoin volatility will continue to compress over longer periods25:57
Activemedium confidence FinanceCrypto

Bitcoin volatility will continue to compress over longer periods

Since Apr 2026

Barhydt believes that Bitcoin's volatility will continue to decrease over time, with drawdowns becoming shallower (e.g., 50% instead of 80%+). He suggests that annual returns may compress from 50% to 30% per year, but such returns are still exceptional compared to other assets.

“My guess is is we'll see that volatility continue to compress over longer periods of time.” [25:57]
Bitcoinvolatilitycompressionreturnsmaturity
Future Forecasting Group·made 4/16/2026 Source
Bitcoin could reach new all-time highs in 202627:00
Activelow confidence FinanceCrypto

Bitcoin could reach new all-time highs in 2026

Jan 2026 - Dec 2026

While not making a specific price prediction, Barhydt states there is a reasonable chance Bitcoin could see new all-time highs within the same year (2026), assuming macroeconomic and geopolitical conditions stabilize.

“I do think there's a reasonable chance we could see all-time highs again this year.” [27:00]
Bitcoinall-time highprice2026
Future Forecasting Group·made 4/16/2026 Source
Cryptographically relevant quantum computer is 10–15 years away33:31
Activemedium confidence TechnologyScience

Cryptographically relevant quantum computer is 10–15 years away

Since Apr 2026

Barhydt assesses that a quantum computer capable of breaking Bitcoin's cryptography is about 10 to 15 years away, and the first such machines will be extremely expensive and likely used for national security purposes rather than attacking crypto. He downplays the immediate quantum threat to Bitcoin.

“a cryptographically relevant uh quantum computer, CRQC we call it, capable of doing what I'm saying is probably 10 to 15 years away.” [33:31]
quantum computingBitcoincryptographyCRQCthreat
Future Forecasting Group·made 4/16/2026 Source
Man-in-the-middle attack on Bitcoin transactions will become possible in 15–20 years36:20
Activemedium confidence TechnologyScienceCrypto

Man-in-the-middle attack on Bitcoin transactions will become possible in 15–20 years

Since Apr 2026

Barhydt explains that a quantum computer fast enough to perform a man-in-the-middle attack on unconfirmed Bitcoin transactions (within 10 minutes) is about 15 to 20 years away. He advocates for upgrading Bitcoin now via BIP 360 to mitigate this future risk.

“that's even harder. So that's like 15 to 20 years out in my opinion.” [36:20]
quantumBitcoinman-in-the-middleBIP 360transaction security
Future Forecasting Group·made 4/16/2026 Source
Consumer transactions will migrate to Solana, Sui, Algorand over Ethereum L2s42:20
Activemedium confidence TechnologyCrypto

Consumer transactions will migrate to Solana, Sui, Algorand over Ethereum L2s

Since Apr 2026

Barhydt predicts that due to Ethereum's poor scalability decisions, many consumer transactions will move to Layer 1 blockchains like Solana, Sui, and Algorand, which have demonstrated high throughput (e.g., Solana processing Visa-level volumes during the Trump meme coin launch). He believes Ethereum's value will continue to dissipate to L2s unless changes are made.

“I think a lot of consumer transactions are going to migrate to the likes of Solana and, you know, Sui, Algorand, whatever” [42:20]
EthereumSolanaSuiAlgorandL2scalability
Future Forecasting Group·made 4/16/2026 Source
AI agents will create billions of crypto wallets transacting peer-to-peer46:10
Activemedium confidence TechnologyCryptoScience

AI agents will create billions of crypto wallets transacting peer-to-peer

Since Apr 2026

Barhydt envisions a future where AI agents autonomously spin up wallets and transact directly on Layer 1 blockchains using native tokens (not stablecoins), due to no KYC requirements. This could lead to billions of wallets as every individual runs multiple agents. He sees the meme coin explosion as a successful stress test for such transaction volumes.

“That means potentially billions of wallets, not millions, billions” [46:10]
AI agentswalletsblockchainpeer-to-peertransaction volume
Future Forecasting Group·made 4/16/2026 Source
Bank wires will become obsolete within 5 years50:14
Activemedium confidence FinanceTechnology

Bank wires will become obsolete within 5 years

Jan 2026 - Dec 2031

Barhydt claims that the pain of sending a bank wire will disappear within five years as blockchain-based settlement becomes ubiquitous, making traditional wire transfers a thing of the past.

“the pain of sending a bank wire is is 5 years away from just going into oblivion forever.” [50:14]
bank wireblockchainobsoletesettlementfuture
Future Forecasting Group·made 4/16/2026 Source
Crypto will become deeply entrenched in everyday life within 10 years51:51
Activemedium confidence TechnologyFinanceCrypto

Crypto will become deeply entrenched in everyday life within 10 years

Since Apr 2026

Barhydt predicts that in ten years, crypto and digital asset rails will be so integrated into daily life that most people will use them without realizing it, similar to how AI is becoming embedded. He believes this will surprise those who are not following the space closely.

“People will be stunned at how much is at how entrenched it will become and has become by then into everything we do.” [51:51]
crypto adoptioneveryday lifeentrenchedfuturedigital assets
Future Forecasting Group·made 4/16/2026 Source
Ongoing war-torn conditions in a desert region16:00
Activelow confidence NewsMilitary

Ongoing war-torn conditions in a desert region

Since Apr 2026· Middle East

One part of the ideogram (point A) is described as depicting a dusty, dirty, rubble-filled environment, associated with destruction and aftermath of conflict on a smaller scale, not explosive but war-torn. It feels urban and poor, similar to but not the same as Iran. This is interpreted as a symbol or representation of the general global situation at that time—continuing conflicts in arid regions contributing to a negative market sentiment.

“I do get a sense of um, you know, dusty, dirty, rubble, brown, tan. It does seem more poor... definitely feels like destruction, but on a smaller scale.” [16:00]
wardestructionrubbledesertconflict
Second House RV·made 4/15/2026 Source
Redstone price surge35:35
Activemedium confidence CryptoFinance

Redstone price surge

Since Apr 2026

Pearl's Redstone investment is predicted to go ballistic, with the token's price expected to rise significantly. The speaker mentions a 132% move from 10 to 24 cents on Coinbase, indicating a strong buy signal with high volume. The prediction suggests that Redstone will continue to perform well, possibly going to the moon, based on chart patterns and volume analysis. The context is a crypto trading tutorial where participants are learning to invest.

“Watch Pearl when Redstone goes ballistic. Watch it go. Watch it go to the moon.” [35:35]
Redstonepricesurgecryptoinvestment
Future Forecasting Group·made 4/15/2026 Source
Crypto winter accumulation opportunity11:34
Activemedium confidence CryptoFinance

Crypto winter accumulation opportunity

Since Apr 2026

The speaker states that the current crypto winter is the best time to accumulate crypto assets, as prices are at support levels and trading sideways. This implies that a future market upturn will reward those who buy now. The reasoning is based on market cycles and low selling pressure, indicating a potential bullish phase ahead.

“The longer it stays low like this, it's the better, especially for people just getting in. Like this is the Like you mentioned, this is the best time to accumulate crypto in this current cycle that we're in” [11:34]
accumulationcrypto wintermarket cyclesupport
Future Forecasting Group·made 4/15/2026 Source
Strait of Hormuz oil cutoff causes gas rationing in South Korea0:27
Activemedium confidence NewsPoliticsEnergyMilitary

Strait of Hormuz oil cutoff causes gas rationing in South Korea

Apr 2026 - Open· South Korea

The speaker reports that South Korea, which gets 80% of its oil via the Strait of Hormuz, has had that supply cut off due to conflict. As a result, gasoline prices are high and the government has imposed rationing on government vehicles: driving is allowed only one day per week based on license plate numbers, cutting 80% of government traffic. The prediction is that this fuel crisis will persist and affect daily life in South Korea.

“South Korea gets about 80% of its oil through the Strait of Hormuz and that has been cut off.” [0:27]
Strait of Hormuzoil cutoffgas rationingSouth Koreagovernment vehicles
Future Forecasting Group·made 4/15/2026 Source
South Korea's government driving restrictions reduce traffic by 80%1:52
Activemedium confidence NewsPoliticsEnergy

South Korea's government driving restrictions reduce traffic by 80%

Apr 2026 - Open· South Korea

The speaker describes a new rationing system for government vehicles in South Korea: license plates ending in 1-2 drive one day, 2-4 the next, etc., effectively cutting out 80% of government vehicular traffic. He observes noticeably less traffic than previous visits, implying the policy is effective and ongoing.

“they're cutting out 80% of the vehicular traffic in government vehicles in South Korea.” [1:52]
government vehiclesdriving restrictionsrationingSouth Koreatraffic reduction
Future Forecasting Group·made 4/15/2026 Source
Iran war impacts South Korean lifestyle0:17
Activemedium confidence NewsMilitaryEnergyPolitics

Iran war impacts South Korean lifestyle

Apr 2026 - Open· South Korea

The speaker explains that the conflict with Iran (referred to as 'the Iran War') has directly impacted South Korea, as the oil supply through the Strait of Hormuz is cut off. Koreans are changing their lifestyles due to high gas prices and rationing, and the topic is a major concern in the country. This implies the war's effects on non-combatant nations will continue.

“They're talking about it. They're having to change their lifestyles and it's big news here.” [0:17]
Iran warStrait of Hormuzlifestyle changesgas pricesSouth Korea
Future Forecasting Group·made 4/15/2026 Source
Americans less affected by oil crisis than South Koreans2:14
Activemedium confidence NewsEnergyPolitics

Americans less affected by oil crisis than South Koreans

Apr 2026 - Open· United States vs South Korea

The speaker contrasts the severe impact of the oil cutoff in South Korea with the situation in America, stating that people in the U.S. are not feeling the effects as strongly. This suggests a disparity in how the global oil crisis affects different countries.

“People in America are not feeling it like they are here in Korea.” [2:14]
Americaoil crisisdisparitygas pricesSouth Korea
Future Forecasting Group·made 4/15/2026 Source
Increase in sudden deaths and exit points21:00
Activelow confidence DisastersHealth

Increase in sudden deaths and exit points

Since Apr 2026

The speaker claims that many people are taking 'random exit points'—dying suddenly due to freak accidents, health crises, or suicide. She asserts that these exit points are predetermined at the soul level, and that individuals unwilling to change are choosing to leave. Additionally, some 'beautiful, powerful souls' are completing their missions and departing to better serve humanity from the other side. She mentions a lot of 'weird random heart attacks' occurring.

“People are taking random exit points. ... people are dying very suddenly. Sometimes it's a freak accident, sometimes it's a health crisis, sometimes it's unfortunately them making that decision.” [21:00]
exit pointssudden deathheart attackssoul contract
Elizabeth April·made 4/13/2026 Source
Acceleration of manifestations19:00
Activelow confidence Woowoo

Acceleration of manifestations

Since Apr 2026

The speaker claims that manifestations are increasing and accelerating—what you speak or think about can rapidly manifest in reality. She gives an example of mentioning a pet tortoise and having one appear the next day. She warns people to watch what they say as things will rapidly manifest.

“Manifestations increasing um and accelerating. You talk about one thing, literally said these words. ... Guess what happens the very next day? I am a proud mom to a desert tortoise.” [19:00]
manifestationaccelerationlaw of attraction
Elizabeth April·made 4/13/2026 Source
Mass awakening via 3D to 5D memory shift6:20
Activelow confidence WoowooScience

Mass awakening via 3D to 5D memory shift

Since Apr 2026

The speaker predicts that as humanity shifts from third-dimensional to fifth-dimensional consciousness, people will experience 3D to 5D memory transition. This involves losing linear memory and gaining access to soul memory (past lives, infinite data). Symptoms include memory loss, forgetting words, and feeling disoriented, but ultimately people will tap into a non-linear, quantum state of being.

“We are moving from a polarity, a binary, a linear state of being ... into a simultaneous, a quantum, a non-linear, a unified, a zero point state of being ... This is why we're losing our words. This is why we're losing our memory.” [6:20]
3D to 5Dmemory shiftconsciousnessascension
Elizabeth April·made 4/13/2026 Source
Children becoming more energetically active13:00
Activelow confidence Woowoo

Children becoming more energetically active

Since Apr 2026

The speaker observes that children are becoming extra crazy, wild, and wired, with an outrageous amount of energy, resembling a full moon energy that has persisted for months. She suggests this is part of the shift and awakening process.

“Are your kids extra crazy? ... it literally feels like a full moon energy vibe ... it feels like we've been in this weird full moon for like 3 months now.” [13:00]
childrenenergyfull moonascension
Elizabeth April·made 4/13/2026 Source
Increased need for help and reduced capacity among healers13:40
Activelow confidence WoowooHealth

Increased need for help and reduced capacity among healers

Since Apr 2026

The speaker predicts that healthcare and service providers (doctors, nurses, therapists, etc.) will notice an increasing number of people needing help, while simultaneously having less capacity to help because they must first help themselves. She claims people in general are 'crazier than normal' or 'weirder than normal'. This is attributed to the energetic shift.

“You've probably noticed that an increasing number of people are needing help right now ... you also noticed that you have a lot less capacity to help them ... people are just like crazier than normal.” [13:40]
healerscapacityneed for helpshift
Elizabeth April·made 4/13/2026 Source
Wilderness period of global crises49:00
Activemedium confidence NewsPoliticsMilitaryEnvironmentDisasters

Wilderness period of global crises

Apr 2026 - Sep 2026

The speaker predicts that the world is entering a period called 'the wilderness' characterized by escalating conflicts, environmental collapse, military conflict, political instability, and social fragmentation. This period is already beginning in 2026 and will intensify over the next few weeks into the summer. The speaker claims that the world is at a point where crises are not just problems but pressure points needed for transformation, and that without real change, the outcome will be unavoidable disaster.

“This is just the beginning of the wilderness... when the entire house of cards, the entire planet turns upside down. So you can expect lots more over the next week, the next two weeks, next three weeks, and into the summer.” [49:00]
wildernessglobal crisisconflict escalationcollapse2026
Farsight·made 4/13/2026 Source
Nuclear war by August 202659:00
Activelow confidence MilitaryDisastersScience

Nuclear war by August 2026

Since Apr 2026

The speaker references Ray Bradbury's short story 'There Will Come Soft Rains' which is set on August 5, 2026, after a nuclear war has destroyed a city. The speaker notes that we are currently in the beginning of the wilderness and August is a few months away, implying a potential nuclear war or catastrophic event by that date. This is presented as a foreshadowing based on the story's setting.

“Today is August 5, 2026... We're right in the middle of starting the wilderness and August is just a few months away. And Ray Bradbury was writing about it.” [59:00]
nuclear warAugust 2026Bradburydestructionwilderness
Farsight·made 4/13/2026 Source
Good ETs will only intervene after humanity changes1:19:09
Activemedium confidence WoowooPoliticsNews

Good ETs will only intervene after humanity changes

Since Apr 2026

The speaker claims that benevolent extraterrestrials (good ETs) have the ability to help humanity but will not intervene until humans demonstrate real, observable, sustained change—specifically open acknowledgment of ET existence and willingness to cooperate. Premature intervention would remove the pressure needed for transformation and lock humanity into failure. The speaker asserts that disclosure is the proof that change has begun, not the end of the process.

“You do not help until change has already begun. Not promised change, not intended change... Real change, observable change, sustained change.” [1:19:09]
ET interventiondisclosurechangehelphumanitytransformation
Farsight·made 4/13/2026 Source
Good ETs sacrificing ships as earnest money1:27:00
Activelow confidence WoowooMilitaryPoliticsTechnology

Good ETs sacrificing ships as earnest money

Since Apr 2026· United States

The speaker claims that the good ETs are allowing their ships to be shot down by the US secret space program (using reverse-engineered bad ET technology) as a form of 'earnest money' to demonstrate their serious intent to help humanity. This sacrifice is meant to convey their goodwill without escalating conflict. The crashes are part of the crash retrieval program discussed in congressional hearings.

“The good ETs are making a true and even profound sacrifice to let humanity know that they are serious about trying to help.” [1:27:00]
crash retrievalET sacrificeearnest moneyUAPsecret space program
Farsight·made 4/13/2026 Source
Humanity must face crisis to trigger disclosure1:34:00
Activemedium confidence NewsPoliticsDisastersEnvironment

Humanity must face crisis to trigger disclosure

Since Apr 2026

The speaker predicts that humanity will experience a sufficiently serious planetary crisis that will force a decision: either acknowledge ETs and cooperate, or continue repeating destructive patterns. The crisis is the necessary pressure for change, and without it, humanity will not budge. This crisis is already unfolding as the world enters the wilderness.

“Unless humanity experiences a sufficiently serious crisis that would obviously need the help of the good ETs for planetary survival, humanity will not budge.” [1:34:00]
crisisdisclosureplanetary survivalwildernesschange
Farsight·made 4/13/2026 Source
Team B wins Super Bowl via ARV1:56
Activelow confidence Paranormal

Team B wins Super Bowl via ARV

Since Apr 2026

Using associative remote viewing (ARV), a viewer describes the future feedback image (Lake Mead) associated with Team B winning the Super Bowl. If the viewer correctly describes Lake Mead as the feedback they will see after the game, it predicts that Team B will win. The prediction is derived from the method described, where the viewer does not see the game outcome but rather the associated image. No specific year or teams are mentioned, but the method is explained as a predictive tool for sports outcomes.

“Hey, team B is going to win that game, right?” [1:56]
associative remote viewingARVSuper Bowlteam Bfeedback
Inside Remote Viewing·made 4/8/2026 Source
Iran war collapsing0:24
Activelow confidence PoliticsMilitary

Iran war collapsing

Since Apr 2026· Iran, Europe, Asia, Taiwan

The speaker claims the war involving Iran is falling apart and that there is good evidence to believe major events will occur in Europe, eventually involving Asia and Taiwan. This prediction suggests a widening conflict beyond Iran into Europe and Asia, with Taiwan being drawn in.

“the whole war in Iran is falling apart. And there's good evidence to believe that stuff is going to be happening in Europe, huge. And eventually Asia and uh Taiwan is probably going to be wrapped up into all of this.” [0:24]
IranwarEuropeAsiaTaiwanconflict
Farsight·made 4/6/2026 Source
Communication breakdown leads to social collapse7:49
Activemedium confidence PoliticsNewsScience

Communication breakdown leads to social collapse

Since Apr 2026

The speaker predicts that communication will increasingly break down, leading to fragmentation, destabilization, loss of trust, and ultimately conflict. This is presented as an ongoing process that will intensify as institutions weaken and the 'wilderness' period sets in.

“It fragments. It destabilizes. It becomes inconsistent. And in that environment, something very specific begins to happen. People stop understanding each other even when they are using the same words. And when that happens, something even more dangerous follows. They stop trusting each other. And when trust disappears, what replaces it is not cooperation. It is tension. It's fear. And very quickly it becomes conflict.” [7:49]
communicationbreakdowntrustconflictsocial collapsewilderness
Farsight·made 4/6/2026 Source
Billionaires purchasing private bunkers and armies16:12
Activelow confidence FinancePoliticsNews

Billionaires purchasing private bunkers and armies

Since Apr 2026

The speaker claims that many of the world's billionaires are purchasing private underground bunkers and entire security apparatuses, indicating that they know a collapse is approaching. This is presented as evidence that a societal collapse is imminent.

“Do you see that many of the world's billionaires are not only purchasing private bunkers, but they're purchasing the entire security apparatus like many armies to go with the bunkers. And they wouldn't do that if they didn't know something. They know that a collapse is approaching.” [16:12]
billionairesbunkerssecuritycollapsepreparation
Farsight·made 4/6/2026 Source
Education as key to rebuilding society23:00
Activemedium confidence SciencePolitics

Education as key to rebuilding society

Since Apr 2026

The speaker suggests that after a societal collapse, education will play a central role in rebuilding, with a focus on literacy, media literacy, and AI learning. However, the traditional academy may be too slow to adapt.

“Despite the impending collapse, there will still be a central role for education systems to adapt to the new reality and there will always be the need of literacy including media literacy and essentially AI and learning within the context of AI.” [23:00]
educationrebuildingliteracyAIcollapse
Farsight·made 4/6/2026 Source
Extraterrestrial communication is telepathic34:34
Activemedium confidence WoowooScience

Extraterrestrial communication is telepathic

Since Apr 2026

The speaker makes a general claim that communication with extraterrestrials is primarily telepathic, mind-to-mind, and not linguistic. This is presented as a consistent pattern across government accounts, academic research, abduction reports, and military experiments.

“Communication is not happening primarily through words. It is happening directly mind to mind.” [34:34]
telepathyextraterrestrialcommunicationmindUFO
Farsight·made 4/6/2026 Source
Extraterrestrials want to communicate with all humanity54:00
Activelow confidence WoowooScience

Extraterrestrials want to communicate with all humanity

Since Apr 2026

The speaker predicts that the extraterrestrials they interact with want to communicate with all of humanity, not just a small group, and are using Farsight's videos to help humans learn telepathic communication.

“These extraterrestrials deeply want to communicate with all Earth humans, not with Farsight members only. But they want our videos of these communications to help other humans understand how these communications work and how they can conduct telepathic communications themselves.” [54:00]
extraterrestrialcommunicationtelepathyhumanityFarsight
Farsight·made 4/6/2026 Source
Communication breakdown leading to social collapse1:34:48
Activemedium confidence PoliticsDisastersNews

Communication breakdown leading to social collapse

Since Apr 2026

The speaker predicts that as communication fragments and becomes distorted, institutions will weaken and trust will erode, leading to increased tension, fear, and eventually conflict. This is framed as an inevitable process as the world enters a 'wilderness' period where shared language breaks down and people stop understanding each other even when using the same words. The prediction is based on analysis of current political polarization, declining trust in institutions, and the spread of miscommunication.

“When communication breaks down, people stop understanding one another. And in some cases, that means that a guy doesn't get to talk with a hot girl at the beach. And in other cases, people die as wars rage.” [1:34:48]
communication breakdownsocial collapsetrustconflictwilderness
Farsight·made 4/6/2026 Source
Extraterrestrial disclosure approaching within months59:12
Activemedium confidence NewsPoliticsScience

Extraterrestrial disclosure approaching within months

Apr 2026 - Jul 2026

The speaker states that disclosure of extraterrestrial presence is no longer being ignored and is being normalized in media and public discourse. He claims that within the next few months (as of April 2026), a significant disclosure event will occur, citing the upcoming Stephen Spielberg film 'Disclosure Day' in June 2026 as a touchstone, and mentions that mainstream influencers like Bill Maher are increasingly discussing the topic. The prediction implies that the narrative is being controlled to shape public perception.

“it looks like it's really heading up for something that's going to be happening um well within the next few months.” [59:12]
disclosureextraterrestrialUFOmediamainstream
Farsight·made 4/6/2026 Source
Telepathic communication as standard for ET contact1:31:58
Activemedium confidence ScienceParanormalTechnology

Telepathic communication as standard for ET contact

Since Apr 2026

The speaker asserts, based on decades of research including government briefings, academic studies, and Farsight's own remote viewing sessions, that telepathic mind-to-mind communication is the primary method used by extraterrestrials and is real but not easily accessible to most humans. He claims that this form of communication can be developed as a skill through disciplined training, and that Farsight has achieved stable two-way telepathic communication with ETs, which is now being recorded and published to teach humanity.

“Telepathic communication is real, but not easily accessible to humans.” [1:31:58]
telepathyextraterrestrialcommunicationremote viewingconsciousness
Farsight·made 4/6/2026 Source
War escalation in Iran, Europe, Asia, and Taiwan56:42
Activemedium confidence PoliticsMilitaryDisasters

War escalation in Iran, Europe, Asia, and Taiwan

Apr 2026 - Open· Iran, Europe, Asia, Taiwan

The speaker claims that the war in Iran is collapsing and there is evidence that conflict will spread to Europe, then Asia, and that Taiwan will be involved. This is presented as a continuation of previously made predictions that are now materializing.

“the whole war in Iran is falling apart. And there's good evidence to believe that stuff is going to be happening in Europe. Huge. and eventually Asia and uh Taiwan is probably going to be wrapped up into all of this.” [56:42]
warIranEuropeAsiaTaiwanescalation
Farsight·made 4/6/2026 Source
Destruction of man-made object in space with DNA alteration12:30
Activemedium confidence SpaceScienceNews

Destruction of man-made object in space with DNA alteration

Apr 2026 - Open

An energy event in space destroys a man-made object, producing intense light and debris. The event involves a double-layered stream containing modified DNA particles that float down through the atmosphere as a luminescent glow. This suggests possible biological or genetic material being released from a space structure, causing a change in DNA. The event may be linked to a Mars-Saturn conjunction.

“It feels like a destruction of a man-made object in space. There's intense light and debris. There's death of life and a change in the DNA due to this event.” [12:30]
space debrisDNAman-made objectbioluminescenceatmosphere
Second House RV·made 4/4/2026 Source
Coastal city attack with military movement south-southeast16:00
Activemedium confidence MilitaryNewsDisasters

Coastal city attack with military movement south-southeast

Apr 2026 - Open· Sub-Saharan Africa (coastal)

A military-type movement of forces heading south and southeast along a coast into the outer portions of a coastal city, which feels sub-Saharan. A building is destroyed with burnt smells, cordite, and bitter/salty odors. This suggests a military assault or attack on a coastal urban area.

“I got the impressions of a coastal city and it felt somewhat sub-Saharan and almost like it was a military type of movement where we had forces or individuals moving south and southeast along coastal into what seemed to be like the outer outer portions of of a city.” [16:00]
military movementcoastalattacksub-Saharanbuilding destroyed
Second House RV·made 4/4/2026 Source
Political realignment after destruction17:00
Activemedium confidence PoliticsNews

Political realignment after destruction

Apr 2026 - Open

Following a destructive event, there is an uneasy alliance or new political status quo formed. Fearful people are brought together chaotically in a top-down process initiated by government or corporations. This is an imperfect merging of old and new groups, tolerated as part of organic change. It resembles chemotherapy—unpleasant but necessary.

“What what I've called this session is an uneasy alliance, like a new maybe political status quo.” [17:00]
political alliancestatus quogovernmentcorporatechaotic
Second House RV·made 4/4/2026 Source
Leaked video of energy event near water19:00
Activemedium confidence NewsTechnologyParanormal

Leaked video of energy event near water

Apr 2026 - Open· At sea or near water

A video of an energy event at sea or near water, involving a boat or structure in the sky, is leaked to the public, catching people by surprise. The event is observed on a screen and may be related to UFOs or advanced technology. It feels game-changing and intriguing.

“It was like an energy event involving a boat or a structure, something in the sky that was observed and that, you know, that this video of whatever it is, this energy event that I'm observing became public through some kind of process like a leak.” [19:00]
leaked videoenergy eventUFOboattechnology
Second House RV·made 4/4/2026 Source
Game-changing AI breakthrough release22:00
Activelow confidence TechnologyScienceNews

Game-changing AI breakthrough release

Apr 2026 - Open

A release of a new technological breakthrough, likely in AI, emerges from a structure. It feels game-changing, similar to ChatGPT, and impacts people with excitement and apprehension. The event involves a partnership or collaboration between two entities and may be overseen by a figure (possibly Trump). This release is significant and alters public consciousness.

“It reminded me kind of a chat GPT, like something that was kind of new and exciting, like a game-changing release of something technological that impacted people.” [22:00]
AI breakthroughgame-changingreleasepublic consciousnesspartnership
Second House RV·made 4/4/2026 Source
Trump in conflict with structure over Epstein files23:00
Activelow confidence PoliticsNews

Trump in conflict with structure over Epstein files

Apr 2026 - Open

Donald Trump is depicted in a confrontation with a structure or organization, with phrases 'got him by the balls' and 'biting the hand that feeds', possibly related to the Epstein files. This may coincide with the main news event, but is uncertain.

“I had this phrase got him by the balls that came up... Also this phrase, biting the hand that feeds.” [23:00]
TrumpEpsteinconflictorganizationfiles
Second House RV·made 4/4/2026 Source
Lost Atlantean Library Beneath Giza Pyramids
Activelow confidence ParanormalWoowoo

Lost Atlantean Library Beneath Giza Pyramids

Since Apr 2026· Giza, Egypt

Remote viewers claim to have accessed a hidden library beneath the Giza pyramids containing Atlantean knowledge. The prediction is that this library exists as a physical or interdimensional repository of forbidden wisdom from the lost civilization of Atlantis. Access requires permission from guardian beings, who screen visitors based on intent or DNA. The library is described as an immersive, time-distorting interface that allows users to absorb knowledge through multi-sensory experience. This claim suggests that physical exploration or discovery of this library may occur if humans become 'worthy' and ask correctly.

“I got through eventually. I was given access because I asked... library. Here to learn, to access knowledge that is secret, hidden, and forbidden. Atlantean knowledge and wisdom.” [0:00]
AtlantislibraryGizaremote viewinghidden knowledge
Down The Rabbit Hole·made 4/2/2026 Source
Guardian Beings Screening Human Access7:07
Activelow confidence ParanormalWoowoo

Guardian Beings Screening Human Access

Since Apr 2026· Giza, Egypt

A prediction that non-human guardian beings control access to a hidden Atlantean library or knowledge repository. These beings are described as tall, blonde, long-limbed, wearing blue capes, acting as sentries or mentors. They screen visitors by requiring correct questions, codes, or DNA. This implies that humanity will only gain access to certain hidden knowledge or ancient sites when they meet specific spiritual or biological criteria, and that such encounters may involve deception or aggression from both sides.

“This being was standing at the entryway, just standing guard... not allowing me through because I have to ask the right questions, say the right code, or have the correct DNA.” [7:07]
guardianDNAaccessnon-humanAtlantis
Down The Rabbit Hole·made 4/2/2026 Source
Cataclysm at End of Atlantean Civilization8:49
Activelow confidence DisastersParanormal

Cataclysm at End of Atlantean Civilization

Since Apr 2026

A prediction that Atlantis was destroyed by a sudden cataclysm at the end of a cycle, but with prior warning. The transcript states there was a 'full download of what was to come.' This suggests that the Atlanteans had foreknowledge of their civilization's end, possibly implying cyclical events that could recur. The prediction may relate to modern concerns about natural or cosmic disasters repeating, though no specific timeframe or location is given.

“There was a cataclysm at the end of the civilization. It was sudden, but there was warning about it and a full download of what was to come.” [8:49]
cataclysmAtlantiscyclewarningdoom
Down The Rabbit Hole·made 4/2/2026 Source
Global System Destabilization and Narrative Collapse45:40
Activemedium confidence Politics

Global System Destabilization and Narrative Collapse

Since Mar 2026

The speaker asserts that the current global system, characterized by a single dominant narrative, is destabilizing and losing its ability to maintain control. This is presented as an observable phenomenon in the news, with increased exposure to alternative viewpoints. The prediction is that this destabilization will continue, leading to a 'wilderness' period where people encounter information that doesn't fit the old structure. No specific timeframe or location is given, but it is described as already underway.

“The system is losing its ability to maintain a single narrative.” [45:40]
system collapsenarrativedestabilizationglobal change
Farsight·made 3/30/2026 Source
Humanity's Choice in the Wilderness46:00
Activemedium confidence SocietyPsychology

Humanity's Choice in the Wilderness

Since Mar 2026

The speaker predicts that as humanity enters a metaphorical 'wilderness' due to the collapse of old structures, individuals will face a choice: either seek another authoritarian system or recognize the opportunity for genuine free will. Most will choose the familiar script, but a minority will hesitate and achieve true awareness. This is framed as an inevitable psychological evolution. No specific timeline or location.

“The question is not whether people will have a choice. They will have a choice. The question is whether they will recognize it.” [46:00]
choiceawarenesswildernessfree will
Farsight·made 3/30/2026 Source
Farsight's Mission to Convey Immortality1:08:00
Activelow confidence ScienceParanormal

Farsight's Mission to Convey Immortality

Since Mar 2026

The speaker predicts that Farsight's primary role is to convince humanity of its eternal nature, using remote viewing as proof. This is described as 'completing the education of Adam and Eve' and helping people 'eat from the tree of life' — i.e., realize they are immortal spiritual beings. The prediction implies that this realization will become widespread, fundamentally changing human self-perception. No specific timeframe.

“Farsight's primary job is to convince humanity that all beings are eternal. No one ever really dies.” [1:08:00]
immortalityremote viewingconsciousnessfarsight
Farsight·made 3/30/2026 Source
Imminent Civilization Collapse1:12:00
Activemedium confidence PoliticsDisasters

Imminent Civilization Collapse

Since Mar 2026

The speaker states that civilization collapse is beginning and has not yet fully manifested. This is based on a recent ET board meeting where extraterrestrial specialists in bureaucracies during collapse periods provided insights. The prediction is that institutions will dysfunction and society will fall apart, with visible signs already present. The collapse is presented as ongoing or imminent, with no specific end date.

“So the collapse hasn't started yet. It hasn't well it hasn't completely manifested yet, but it's starting. It's beginning and you can see it now.” [1:12:00]
collapsecivilizationinstitutionsbureaucracytransition
Farsight·made 3/30/2026 Source
Global civilization collapse intensifies47:57
Activemedium confidence PoliticsNews

Global civilization collapse intensifies

Mar 2026 - Open

The speaker predicts that a large-scale collapse of human civilization, including its institutions, governments, and corporations, is beginning and will intensify. This collapse is portrayed as a gradual process that has not yet fully manifested but is starting to become visible. The prediction is based on the speaker's worldview and claimed insights from extraterrestrial beings specializing in bureaucracy during collapses. The statement implies that the world as we know it is falling apart, leading to a 'wilderness' period. The prediction is tied to a broader narrative of humanity's choice to break free from a controlled system.

“The collapse hasn't started yet. It hasn't completely manifested yet. But it's starting. It's beginning.” [47:57]
civilization collapseinstitutionswildernesstransformation
Farsight·made 3/30/2026 Source
Good ETs will militarily defeat bad ETs in the solar system31:54
Activemedium confidence SpaceMilitaryWoowoo

Good ETs will militarily defeat bad ETs in the solar system

Mar 2026 - Open

The speaker claims that 'good' extraterrestrials have amassed a significant military force in the solar system and have the capability to defeat the 'bad' extraterrestrials in battle. This is presented as a current reality, not a future event. The good ETs are described as having a military advantage within this solar system, though not necessarily in the broader galaxy. This prediction is part of a larger narrative about an ongoing cosmic conflict and the necessity of defense. It suggests that a decisive military confrontation is possible, but its occurrence depends on humanity's free-will request for help.

“In the solar system right now, the good ETs have amassed a huge quantity of military forces. On a military level, they can beat the bad ETs in battle.” [31:54]
good ETsbad ETsmilitary advantagesolar system
Farsight·made 3/30/2026 Source
Humanity will make a free-will decision to request help from good ETs32:46
Activemedium confidence WoowooPolitics

Humanity will make a free-will decision to request help from good ETs

Since Mar 2026· Earth

The speaker predicts that humanity, as a collective, will face a critical decision point where they must consciously request assistance from the 'good' extraterrestrials. This request is necessary for the good ETs to intervene and overthrow the 'bad' ETs' control. The prediction is conditional: if enough individuals recognize their situation and choose differently, the intervention will occur. The speaker notes that currently the masses are controlled by fatigue and distraction, but a shift is possible. This decision is framed as a free-will choice, not something forced.

“There needs to be a free-will decision, however imperfect, for this to happen. They cannot simply invade and kick out the bad ETs...” [32:46]
free willhumanityextraterrestrialsintervention
Farsight·made 3/30/2026 Source
Farsight will convince humanity of eternal consciousness and remote viewing reality39:39
Activemedium confidence ScienceWoowoo

Farsight will convince humanity of eternal consciousness and remote viewing reality

Since Mar 2026

The speaker asserts that Farsight's primary mission is to educate humanity about the eternal nature of consciousness, using remote viewing as proof. The prediction is that through their efforts, more people will come to believe that all beings are immortal spiritual beings (Isbes) and that remote viewing is real. This is presented as necessary for humanity to 'eat from the Tree of Life' and achieve liberation from control. The prediction implies a gradual shift in collective belief, but no specific timeline is given.

“Farsight's primary job is to convince humanity that all beings are eternal. No one ever really dies.” [39:39]
remote viewingeternal consciousnessFarsightimmortality
Farsight·made 3/30/2026 Source
Solar Cycle 25 Intensification6:56
Activemedium confidence ScienceEnvironment

Solar Cycle 25 Intensification

Since Mar 2026

The video predicts that the current solar cycle (Cycle 25) will be stronger than mainstream scientific consensus expected. The speaker claims that their remote viewing sessions indicated heightened solar activity, contrasting with predictions of an underwhelming cycle. This could lead to increased geomagnetic storms, aurora visibility, and potential impacts on satellites and power grids.

“most scientists were saying that it would be underwhelming. We were getting that it would be the opposite, and it's turned out to be that way” [6:56]
solar cyclegeomagnetic stormssolar activityremote viewing
Adventures in Remote Viewing·made 3/28/2026 Source
Post-Apocalyptic Event Requiring Cleanup and Rescue6:57
Activelow confidence DisastersNews

Post-Apocalyptic Event Requiring Cleanup and Rescue

Since Mar 2026

The session describes a scene of debris, fog, containment, and a figure in an airtight suit performing cleanup and rescue operations. This is interpreted as a possible fallout event, though not necessarily nuclear. The speaker mentions a project on avoiding nuclear war that suggested hiding underground or going off planet. This implies a significant disaster that disrupts normal life, requiring protective gear and recovery efforts.

“I see dust, debris, fog, containment, like Asher falling event, fallout event” [6:57]
falloutcleanuprescuedisastercontainment
Adventures in Remote Viewing·made 3/28/2026 Source
Emergence of Enclosed Futuristic Cities10:40
Activelow confidence TechnologyEnvironment

Emergence of Enclosed Futuristic Cities

Since Mar 2026

The video predicts the development of enclosed, futuristic cities with bubble domes, special landing strips, and harmonious integration with nature. These cities are described as places where people are communal, happy, and engaged in new projects. The speaker suggests these cities represent a positive shift in society, possibly post-disaster, with advanced technology and a focus on community and nature.

“see people like staring out in this area that could be like a city futuristic looking bubble dome buildings that comes up” [10:40]
futuristic citiesbubble domescommunal livingnaturetechnology
Adventures in Remote Viewing·made 3/28/2026 Source
Widespread Use of Telepathy and Psychic Abilities14:44
Activelow confidence ScienceParanormal

Widespread Use of Telepathy and Psychic Abilities

Since Mar 2026

The session indicates a future where telepathy and psychic abilities become more common, enabling mind-to-mind connection and unity. This is described as a natural state that people will return to, possibly as part of a paradigm shift. The speaker also mentions time travel and distant travel as potential developments.

“I have the sense of telepathy which may be something more in use or at play here” [14:44]
telepathypsychic abilitiesmind connectionparadigm shift
Adventures in Remote Viewing·made 3/28/2026 Source
Geomagnetic Reversal or Pole Shift1:21
Activelow confidence ScienceDisasters

Geomagnetic Reversal or Pole Shift

Since Mar 2026

The video references 'cyclical potential cataclysmic events, pole shift' as part of the paradigm shift discussion. While not explicitly predicting a pole shift, it suggests such events are part of the expected changes. The session also mentions magnetic fields and changes in the atmosphere, which could be related to geomagnetic disturbances.

“talking about cyclical potential cataclysmic events, pole shift” [1:21]
pole shiftgeomagnetic reversalcataclysmparadigm shift
Adventures in Remote Viewing·made 3/28/2026 Source
Iran Conflict in Near Term1:35
Activelow confidence PoliticsMilitary

Iran Conflict in Near Term

Since Mar 2026· Iran

The speaker mentions a session that references Iran, implying potential conflict or significant events involving Iran in the near term. The context is the socio-political implications of the 2024 election, so this may be related to geopolitical tensions.

“One session mention mentions Iran and those kind of things” [1:35]
Iranconflictgeopoliticselection
Adventures in Remote Viewing·made 3/28/2026 Source
Meteor or Comet Event2:50
Activelow confidence ScienceSpace

Meteor or Comet Event

Since Mar 2026

The session describes cosmic activity with objects raining down, possibly meteors, asteroids, or comets. This is seen alongside a fleet of objects, suggesting a significant celestial event. The speaker ties this to the paradigm shift, implying a major observable astronomical event.

“cosmic or atmospheric activity, looks like objects raining down, which could be meteors, asteroids, comet related” [2:50]
meteorsasteroidscometscosmic eventparadigm shift
Adventures in Remote Viewing·made 3/28/2026 Source
Colorful Sky Phenomena Indicates Atmospheric Change4:06
Activelow confidence ScienceEnvironment

Colorful Sky Phenomena Indicates Atmospheric Change

Since Mar 2026

The video repeatedly mentions magenta, orange, crimson, and gold skies, interpreted as signs of changing atmospheric composition or solar effects. This is linked to solar activity and could indicate increased auroral activity or other atmospheric changes.

“magenta sky, that's something that's come up a lot” [4:06]
magenta skyatmospheric changesolar activityaurora
Adventures in Remote Viewing·made 3/28/2026 Source
Time Travel Experiments in Future13:00
Activelow confidence ScienceTechnology

Time Travel Experiments in Future

Since Mar 2026

The speaker describes a dream where people, including a man with twin daughters, attempt time travel experiments in an open-door school. This is presented as a hint of what the future holds, suggesting that time travel research may become a reality.

“people were attempting science experiments and an open door school. It was like a time travel experiment.” [13:00]
time travelexperimentsfuture technologyparadigm shift
Adventures in Remote Viewing·made 3/28/2026 Source
Economic Collapse from Trade Standstill14:32
Activelow confidence FinancePolitics

Economic Collapse from Trade Standstill

Since Mar 2026

The video warns that current conflicts and trade standstills could lead to collapse if not resolved. This is tied to the broader socio-political changes, suggesting a possible economic downturn or restructuring.

“we're looking at possible collapse if things don't get back on track” [14:32]
economic collapsetrade standstillconflictparadigm shift
Adventures in Remote Viewing·made 3/28/2026 Source
Medical remote viewing applications help heal0:54
Activemedium confidence ScienceHealthParanormal

Medical remote viewing applications help heal

Since Mar 2026

The transcript describes a case where a woman in a wheelchair for 8 years regained leg movement and eventually walked again after 300 remote viewing sessions. The speaker claims this demonstrates a principle: practitioners do not heal but help individuals heal themselves. This suggests a general claim that remote viewing or similar psychic techniques can assist in physical healing when applied to willing subjects over many sessions. The prediction implies that such medical applications of remote viewing are effective, as evidenced by the reported outcome. The timeframe is not specified beyond the sessions and subsequent six-month progress, but it is presented as a past event that validates the approach.

“And from that we learned about what we call now the medical applications. And that is where you can help a person heal themselves.” [0:54]
remote viewinghealingmedical applicationswheelchairpsychic
Inside Remote Viewing·made 3/23/2026 Source
Remote viewing used for emergency blood pressure reduction0:19
Activelow confidence ScienceHealth

Remote viewing used for emergency blood pressure reduction

Since Mar 2026· Cornell University (Ithaca, NY)

The speaker describes a past study at Cornell University where a remote viewer (himself) was able to lower blood pressure in hypertension patients during monitored sessions. The study was double-blind: the doctor would put a patient on a monitor and call the remote viewer, who would flip a coin to decide whether to perform a remote viewing session aimed at lowering blood pressure. Results showed a drop of up to 50-70 points when the remote viewer did the work, but no change when he did not. However, the effect was temporary, as patients' blood pressure returned to high levels when they went back to their normal lives. The speaker concludes that remote viewing could be used in emergency situations to help save a patient, but long-term effects are unlikely without addressing the underlying lifestyle causes. This is presented as a finding from a completed study.

“if I did do the work, there would be a drop in blood pressure sometimes up to 50 or 70 points in blood pressure.” [0:19]
remote viewingblood pressurehypertensiondouble-blind study
Inside Remote Viewing·made 3/21/2026 Source
Alternative energy healing legitimized for insurance coverage2:10
Activemedium confidence ScienceHealth

Alternative energy healing legitimized for insurance coverage

Since Mar 2026

The speaker mentions a man named Safely Savva who has set up a system to connect alternative energy workers with doctors in a scientific framework. This system includes recording results, writing formal reports, and conducting double-blind studies. The end goal is to prove that alternative energy healing works and to persuade insurance companies to include it in insurance coverage. The timeframe is not specified, but the speaker implies it is an ongoing effort. This prediction is about a future where alternative healing is recognized and covered by insurance, based on Savva's current work.

“he is in the process of legitimizing alternative energy healing with doctors with the end goal of saying to the insurance companies, 'Look, we have proven that this works. So included in your insurance coverage.'” [2:10]
alternative energy healinginsurancedouble-blind studylegitimization
Inside Remote Viewing·made 3/21/2026 Source

Past

92
SpaceX IPO launch valuation below 2 trillion22:44
Pastmedium confidence Finance

SpaceX IPO launch valuation below 2 trillion

Jun 2026 - Jun 2026

Based on a mind probe of Elon Musk and Steve Jobs, the prediction states that the SpaceX IPO will launch at a market cap between 1.4 and 2 trillion dollars, specifically below 2 trillion. The reasoning given is that the valuation is too high relative to revenue and the vision is not achievable in the near term, leading to a more modest launch valuation than some market expectations.

“I think it's going to be lower. ... It is going to be above a one, but below a two.” [22:44]
SpaceXIPOvaluationmarket cap
Psychic Liz Cross·made 6/9/2026 Source
S&P 500 June 2026 crash and recovery3:40
Pastmedium confidence Finance

S&P 500 June 2026 crash and recovery

Jun 2026 - Jun 2026

The speaker states that a market crash predicted for early June 2026 has occurred, with the S&P 500 experiencing a sharp drop on June 5th. He notes that the relative strength index is oversold and that the dip may continue briefly before recovering. He expects the market to bounce back by the end of June, potentially returning closer to where it started the month, with a possibility of a slight increase. The context includes previous predictive success and the influence of euphoria and correction cycles.

“I still feel like we're going to have some volatility the next couple of weeks, and then still kind of end the month back up. Maybe we end up kind of closer to where we were at the beginning of the month, maybe a little higher.” [3:40]
S&P 500stock market crashrecoveryJune 2026volatility
Second House RV·made 6/8/2026 Source
Large explosion or impact in Eastern Europe7:48
Pastmedium confidence DisastersMilitary

Large explosion or impact in Eastern Europe

Sep 2020 - Dec 2020· Eastern Europe

A massive energy event creates a blast wave, crater, and concentric rings of devastation, vaporizing everything at the center and knocking down trees up to 30 miles away. It severs a pipeline, leaves burnt trucks, and creates a dead zone. Military convoys and an underground command post appear. The area is likely Eastern Europe. The timeframe is fall 2020, around October 3 plus/minus 3 days.

“A big energy event, like a big pressure blast wave. birds 25 or 30 miles away are going to all get startled and flutter off. Now, the term 22,000 rads came to mind. I saw this huge crater. a pipeline that's been severed. trucks that are burnt skeletons. A dead zone. Felt kind of Eastern Europe to me.” [7:48]
explosioncraterblast waveradiationEastern Europewar
Future Forecasters·made 6/6/2026 Source
Air attacks on civilian infrastructure resume0:56
Pastmedium confidence MilitaryDisasters

Air attacks on civilian infrastructure resume

Jun 2026 - Jun 2026

A series of air attacks on civilian infrastructure is predicted to resume, leading to thousands of deaths and a humanitarian crisis. The prediction does not specify the parties involved but implies a continuation or escalation of existing conflicts. The context suggests this is part of a broader pattern of violence in June 2026.

“air attacks on civilian infrastructure, resume, thousands dead, humanitarian nightmare” [0:56]
air attackscivilian infrastructurethousands deadhumanitarian crisisJune 2026
Future Forecasters·made 6/5/2026 Source
Resumption of Iran war0:35
Pastmedium confidence MilitaryPolitics

Resumption of Iran war

Jun 2026 - Jun 2026· Middle East

A war involving Iran is predicted to resume or escalate, possibly involving Israel and/or the United States. The remote viewers perceived military actions including air attacks and potential radioactive leaks. The exact trigger and participants are unclear, but the Middle East is the likely location.

“resumption of the Iran war either between just Israel and Iran or US is involved” [0:35]
Iran warIsraelUSradioactive leaksMiddle East
Future Forecasters·made 6/5/2026 Source
Radioactive leaks from nuclear facility3:20
Pastlow confidence DisastersEnergyEnvironment

Radioactive leaks from nuclear facility

Jun 2026 - Jun 2026

A radioactive leak from a nuclear power plant or similar facility is predicted, with the contaminant spreading via wind. The remote viewer described it as a biohazard unrelated to a bomb, possibly involving plutonium waste dissipation. This could be a consequence of military action or an accident.

“Something just comes out like waste dissipation. I see that's traveling by wind. It was just more like a biohazard. The plutonium thing.” [3:20]
radioactive leaknuclearplutoniumbiohazardwind dispersion
Future Forecasters·made 6/5/2026 Source
Spectacular meteor video captured2:00
Pasthigh confidence ScienceSpace

Spectacular meteor video captured

Jun 2026 - Jun 2026

A large meteor entering Earth's atmosphere is predicted to be captured on video in a one-in-a-million clear shot. This event is expected to be spectacular and widely shared, though no specific location or timing beyond June 2026 is given.

“The spectacular video catch of a large meteor entering the atmosphere. It's like a one-in-a-million clear shot.” [2:00]
meteorvideoatmosphereone-in-a-millionJune 2026
Future Forecasters·made 6/5/2026 Source
Torpedo attack on small warship1:52
Pastlow confidence Military

Torpedo attack on small warship

Jun 2026 - Jun 2026

A torpedo attack on a military vessel is predicted, specifically a small warship of corvette size or smaller. The attack is described as 'spectacular' and likely occurs in an ocean setting, possibly related to geopolitical tensions in the Middle East.

“another ocean theme here, kind of like a torpedo attack on a military vessel. And it looks small, like Corvette size or smaller type warship.” [1:52]
torpedo attackwarshipcorvettemilitary vesselocean
Future Forecasters·made 6/5/2026 Source
Grenade attack on public transport2:08
Pastmedium confidence NewsMilitary

Grenade attack on public transport

Jun 2026 - Jun 2026

A grenade is thrown on a bus or train by a seated individual, suggesting a premeditated attack on public transportation. The remote viewer described a person leaning down and lightly tossing a hand grenade down the center aisle of a closed space, implying potential casualties and panic.

“he's seated and he just leans down and he just lightly tosses a hand grenade down the center aisle” [2:08]
grenadepublic transportbustrainattack
Future Forecasters·made 6/5/2026 Source
Xi Jinping presents challenge in Strait of Hormuz5:28
Pastmedium confidence Politics

Xi Jinping presents challenge in Strait of Hormuz

Jun 2026 - Jun 2026· Strait of Hormuz

Chinese leader Xi Jinping is predicted to 'up his game' and present a passive challenge to the US in the Strait of Hormuz. This implies increased Chinese assertiveness in this strategic waterway, potentially affecting global oil shipping and geopolitical tensions.

“Xi Jinping ups his game, presents in the Strait of Hormuz passive challenge to the US.” [5:28]
Xi JinpingStrait of HormuzUSchallengegeopolitics
Future Forecasters·made 6/5/2026 Source
Quarantine and patients treated by doctors5:36
Pastlow confidence HealthNews

Quarantine and patients treated by doctors

Jun 2026 - Jun 2026· non-US

A scenario involving doctors in white lab coats observing and treating patients in quarantine is predicted. This is described as a non-US location, possibly related to a disease outbreak or biohazard incident. The prediction ties into the broader theme of contamination and health emergencies.

“doctors in white lab coats observing and treating patients in quarantine. Now, this is a non-US location.” [5:36]
doctorsquarantinepatientsnon-USbiohazard
Future Forecasters·made 6/5/2026 Source
Market manipulation and steel stocks low1:42
Pastlow confidence Finance

Market manipulation and steel stocks low

Jun 2026 - Jun 2026

A prediction of market manipulation occurring 'after hours' or on a weekend, alongside steel stocks running low. This suggests financial market volatility possibly tied to geopolitical events or supply chain issues. The context implies that the 'working schmucks' will pay more for goods.

“after hours for the purposes of like market manipulation. Then I got like steel stocks running low.” [1:42]
market manipulationsteel stocksafter hoursfinancesupply chain
Future Forecasters·made 6/5/2026 Source
Products banned for harmful ingredients5:16
Pastlow confidence NewsHealth

Products banned for harmful ingredients

Jun 2026 - Jun 2026

A prediction that a whole bunch of products, including well-known popular brand name items, will be banned or taken off the market for harmful ingredients. This specifically mentions makeup and health-related food items, indicating a major recall or regulatory action.

“products banned, taken off the market for harmful ingredients. Make up you health related food items. A whole bunch of them. Some are really well-known popular brand name items.” [5:16]
products bannedharmful ingredientsmakeupfood itemsrecall
Future Forecasters·made 6/5/2026 Source
Planned drive-by shooting made to look random5:04
Pastlow confidence NewsMilitary

Planned drive-by shooting made to look random

Jun 2026 - Jun 2026

A premeditated drive-by shooting targeting one of two people wearing suits is predicted, made to look like a random act. This suggests a politically or personally motivated assassination attempt, but since it does not name specific individuals (only 'people in suits'), it is considered public-interest.

“Planned, premeditated drive-by shooting made to look random. These people are wearing suits. It looks like it's going through both of them but only one of these two people gets” [5:04]
drive-by shootingpremeditatedsuitsassassinationrandom
Future Forecasters·made 6/5/2026 Source
Flooding in US urban areas0:55
Pastmedium confidence DisastersEnvironment

Flooding in US urban areas

Jun 2026 - Jun 2026· USA

Multiple remote viewers independently visualize severe flooding in urban areas within the United States during June 2026. The imagery includes people being swept away by rapidly rising water, with strong sensory details such as rushing water, roaring sounds, and panic. This suggests a significant flood event likely caused by severe weather or infrastructure failure, resulting in casualties and widespread damage.

“Things get carried away, people get washed away. Um and it feels like it's going to be in urban areas in the USA.” [0:55]
floodurbanUSArising waterdrowning
Future Forecasters·made 6/3/2026 Source
Bitcoin price spike in June 20262:06
Pastlow confidence CryptoFinance

Bitcoin price spike in June 2026

Jun 2026 - Jun 2026

A remote viewer predicts that Bitcoin will experience a spike in price during June 2026, characterized by volatile movements upward and downward but ultimately a single sharp peak. This is described as a 'takeoff or landing' moment, suggesting a significant price event that could mark a trend change.

“I then moved to see what Bitcoin would do in June. So, it feels like it's going to be spiky with, you know, some movements up and down, but, you know, generally sideways. Uh but then there's going to be a single peak.” [2:06]
Bitcoinprice spikevolatilitycryptocurrency
Future Forecasters·made 6/3/2026 Source
Plane crash south of UK2:26
Pastlow confidence NewsDisasters

Plane crash south of UK

Jun 2026 - Jun 2026· south of UK

A remote viewer describes a plane crash occurring south of the UK, with visual sensations of a descent and explosive destruction. The viewer also notes a simultaneous financial and political aspect, indicating the crash may involve a high-profile figure or have broader implications.

“Definitely felt like a plane crash. Uh it didn't feel US-based. I felt, you know, like it was like south of me here in the UK.” [2:26]
plane crashUKexplosionaviation accident
Future Forecasters·made 6/3/2026 Source
Financial-political collapse with shock announcement2:50
Pastlow confidence PoliticsFinance

Financial-political collapse with shock announcement

Jun 2026 - Jun 2026

A viewer predicts a major collapse involving both financial and political elements, triggered by a shock announcement in June 2026. This event will negatively impact markets and is linked to a high-profile government building being taken over, suggesting a possible coup or significant political upheaval with financial repercussions.

“So, it was like a double-edged sword here. So, it definitely had a very financial political collapse with a shock announcement going to happen in June. Um and this going to hit the markets negatively.” [2:50]
collapseshock announcementmarket crashgovernment building
Future Forecasters·made 6/3/2026 Source
US military incursion to seize high-profile building3:10
Pastlow confidence MilitaryPolitics

US military incursion to seize high-profile building

Jun 2026 - Jun 2026

A viewer describes a military operation, seemingly US-led and high-tech, to seize a palace or high-profile government building. This incursion is a definite seizure operation, implying a possible coup or targeted mission against a foreign government.

“And I feel the palace or a high-profile government building that's going to be taken over. This is a definite incursion, feels this. There's a definite a military operation to seize. And it feels US-flavored and high-tech.” [3:10]
military incursionseizureUSgovernment building
Future Forecasters·made 6/3/2026 Source
SETI detects strange signals3:47
Pastlow confidence ScienceSpace

SETI detects strange signals

Jun 2026 - Jun 2026

A viewer predicts that the Search for Extraterrestrial Intelligence (SETI) will detect unusual signals from deep space in June 2026, sparking renewed discussion about extraterrestrial signals. This could involve signals from a deep space telescope that are deemed anomalous.

“And it was like the SETI, you know, you don't really hear about SETI anymore, but it's these incoming signals being picked up, deep deep space telescope signals. And uh they this thing gets talked about again. You know, they're like, 'Hey, some strange signals were were picked up.'” [3:47]
SETIsignalsextraterrestrialdeep space
Future Forecasters·made 6/3/2026 Source
US ships surround Carg Island3:57
Pastlow confidence MilitaryPolitics

US ships surround Carg Island

Jun 2026 - Jun 2026· Carg Island

A viewer reports US naval ships surrounding an island referred to as 'Carg Island' (likely a misspelling or unknown location). This suggests a potential military standoff or blockade, possibly related to territorial disputes or geopolitical tensions.

“I'm seeing US ships are on that Carg Island. They're surrounding it. This was a concerning one here.” [3:57]
US NavyshipsblockadeCarg Island
Future Forecasters·made 6/3/2026 Source
Spacecraft explosion or space station incident1:45
Pastmedium confidence SpaceScienceDisasters

Spacecraft explosion or space station incident

Jun 2026 - Jun 2026· space

A viewer visualizes a dramatic spacecraft explosion and trouble on a space station, possibly the Chinese space station. This predicts a significant space accident in June 2026, potentially involving a rocket failure or collision.

“A dramatic video of a spacecraft exploding. A big flare of blossoming explosion up in space station trouble, an incident. Tumbles, not sure if it's the Chinese space station or the international one. I thought I heard Chinese.” [1:45]
spacecraft explosionspace stationChineseaccident
Future Forecasters·made 6/3/2026 Source
Ship sinking precipitating events1:39
Pastlow confidence NewsDisasters

Ship sinking precipitating events

Jun 2026 - Jun 2026

A viewer predicts a ship sinking in June 2026, with a clear visual of the vessel slipping beneath the sea. This event is said to precipitate further events, suggesting it may be a trigger for broader consequences, such as environmental damage or geopolitical tensions.

“A ship sinking. I got a pretty good visual of this ship uh ship with the uh after end up in the water. I want to see it at that angle slipping beneath the sea, and this precipitates more events.” [1:39]
ship sinkingmaritime accidentprecipitate
Future Forecasters·made 6/3/2026 Source
Hidden book or document revealed2:01
Pastlow confidence NewsPolitics

Hidden book or document revealed

Jun 2026 - Jun 2026

A viewer reports a hidden book or document being revealed in June 2026. This could refer to a classified document leak or the discovery of a lost historical text, potentially related to UFOs as suggested in the analysis.

“I got the idea of a hidden book or document revealed.” [2:01]
hidden documentrevealedleakUFO
Future Forecasters·made 6/3/2026 Source
Pipeline overflow causes severe flooding4:07
Pastlow confidence DisastersEnvironment

Pipeline overflow causes severe flooding

Jun 2026 - Jun 2026

A viewer describes an enormous amount of liquid or water flowing from a pipe overflow system, causing rapid and severe flooding. This suggests a major infrastructure failure, possibly a burst water main or industrial pipeline, leading to a flood event.

“Uh with this pipe overflow, there's an enormous amount of liquid or water flowing out of uh an overflow system. It's flooding an area very badly. Water's rising very quickly.” [4:07]
pipelineoverflowfloodinfrastructure failure
Future Forecasters·made 6/3/2026 Source
SpaceX IPO on June 12, 20266:40
Pastlow confidence FinanceSpaceTechnology

SpaceX IPO on June 12, 2026

Jun 2026 - Jun 2026

One viewer states that SpaceX will go public (IPO) on June 12, 2026. This is a specific financial prediction about a major company entering the stock market.

“the SpaceX um is going to go public I think on June 12th as well.” [6:40]
SpaceXIPOpublic offeringJune 12
Future Forecasters·made 6/3/2026 Source
BlackRock anticipating massive Bitcoin drop due to Iran-Israel conflict2:32
Pasthigh confidence MilitaryPoliticsCrypto

BlackRock anticipating massive Bitcoin drop due to Iran-Israel conflict

Jun 2026 - Jun 2026· Iran, Israel

BlackRock is selling Bitcoin via dark pools because they anticipate a massive price drop within the next two weeks. They have insider information that Israel is planning a bombing campaign against terrorist groups, which will trigger a geopolitical crisis involving Iran, leading to financial market volatility. BlackRock intends to buy back Bitcoin at lower prices after the drop.

“They're anticipating a massive drop. So, they're in profit. And they're anticipating a drop and they're going to buy back in.” [2:32]
BlackRockBitcoinIranIsraelbombinginsider information
Psychic Liz Cross·made 6/2/2026 Source
Israel plans bombing campaign within two weeks3:39
Pastmedium confidence MilitaryPolitics

Israel plans bombing campaign within two weeks

Jun 2026 - Jun 2026· Israel

Liz Cross's psychic probing reveals that Israel is planning a bombing campaign against terrorist groups (not Lebanon) in the next two weeks. This intelligence is sourced from inside informants and is expected to impact global markets. The prediction is specific and time-bound.

“Next 2 weeks. ... Israel is planning a bombing campaign.” [3:39]
Israelbombingterrorist groupstwo weeks
Psychic Liz Cross·made 6/2/2026 Source
Mt. Gox to sell 10,400 Bitcoin tomorrow12:12
Pastmedium confidence CryptoFinance

Mt. Gox to sell 10,400 Bitcoin tomorrow

Jun 2026 - Jun 2026

The Mt. Gox entity plans to sell 10,400 Bitcoin (worth about $739 million at current prices) tomorrow. This is a one-time sale and they do not consider it a large amount relative to their holdings. The sale may spook the market but is not part of a larger distribution.

“Yes. ... Tomorrow.” [12:12]
Mt. GoxBitcoinsell10,400
Psychic Liz Cross·made 6/2/2026 Source
Peaceful consciousness shift in first two weeks of June 20261:35
Pastmedium confidence ConsciousnessSocietySpirituality

Peaceful consciousness shift in first two weeks of June 2026

Jun 2026 - Jun 2026

Alyssa predicts a global shift in consciousness beginning in the first two weeks of June 2026, characterized by a peaceful awakening and increased collective focus on love and peace. She describes people making a choice between a higher path of consciousness or passive-aggressiveness, with those choosing the former experiencing increased telepathy, clarity, intuition, and a sense of duty. This shift is portrayed as a positive change amidst global chaos, with a growing number of people opting for peace.

“I feel like what we're going to be seeing is like in the first two weeks of June, this beginning of this shift that's occurring.” [1:35]
consciousness shiftpeaceawakeningtelepathyintuitionlove
Second House RV·made 5/31/2026 Source
Major tech development for maneuvering in near-space by June 20, 202613:12
Pastmedium confidence TechnologySpaceMilitary

Major tech development for maneuvering in near-space by June 20, 2026

Jun 2026 - Jun 2026· USA

David's remote viewing session indicates a novel technology development, possibly related to SpaceX or another aerospace entity, that enables a larger operating envelope for maneuvering in the upper atmosphere or near-space. The technology is described as a fixed structure with a sideways energy jet (like a firehose) that allows more lateral travel and versatility. It is not a rocket launch but a maneuvering thruster for moving payloads in the boundary between atmosphere and space. A press release is expected around June 20, 2026. The tech is seen as a big improvement but not the final version, with applications likely military. The valuation of the involved company (possibly SpaceX) may increase.

“and it it enables USA and Nicaragua, but maybe less likely. So, date around June the 20th for this because I think there is going to be a press release.” [13:12]
maneuvering thrusternear-spaceSpaceXpress releaselateral travelaerospace
Second House RV·made 5/31/2026 Source
Positive geopolitical event in a tropical coastal region with swift resolution32:00
Pastmedium confidence PoliticsMilitary

Positive geopolitical event in a tropical coastal region with swift resolution

Jun 2026 - Jun 2026· Cuba (likely)

Rich's remote viewing session predicts a positive world event in June 2026, starting with a brief violent conflict that ends quickly and is seen as a monumental positive change. The location feels tropical and coastal, with elements of European colonialism (historically or currently). The event involves a surprise military or governmental action, possibly in Cuba or a similar region, resulting in a treaty or truce that brings relief and celebration. The conflict is over before most people realize it started, and the outcome leads to lasting opportunity and advancement for the people involved.

“overall seen as a positive and monumental event. Seemed to be a surprise as it wasn't on people's bingo card.” [32:00]
treatytruceconflict resolutioncelebrationCubasurprise event
Second House RV·made 5/31/2026 Source
S&P 500 initial dip then rise by end of June 202638:00
Pastmedium confidence Finance

S&P 500 initial dip then rise by end of June 2026

Jun 2026 - Jun 2026

Multiple remote viewers (including David, Alyssa, Rich, and the narrator) predict the S&P 500 will experience an initial drop at the beginning of June 2026, possibly a correction, followed by sideways chopping and then a rise to a higher level by the end of the month. The end-of-month peak is seen as the highest point. The dip feels artificial and the market wants to rise. There is reasonable correlation among the viewers' sketches, suggesting a similar pattern.

“I felt like we had this kind of initial drop down um coming into the month and then it kind of would chop sideways a bit and then, you know, we'd we'd end up higher end of the month.” [38:00]
S&P 500stock marketdipcorrectionriseJune 2026
Second House RV·made 5/31/2026 Source
Rescue at sea or resolution of maritime incident in June 202635:00
Pastlow confidence MilitaryDisasters

Rescue at sea or resolution of maritime incident in June 2026

Jun 2026 - Jun 2026· Strait of Hormuz (likely)

The narrator reports a remote viewing session about 'boats and energy propagating waves' and a sense of relief, like a rescue at sea. It felt like an announcement about an incident at sea (possibly near the Strait of Hormuz) that brings relief, not escalation of war. This may relate to Iran or geopolitical tensions in the region. The event is likely later in June 2026.

“This feeling of floating or drifting. But it felt like like a rescue at sea.” [35:00]
maritime incidentrescueIranHormuzreliefboats
Second House RV·made 5/31/2026 Source
S&P 500 dip near end of May 20263:34
Pastmedium confidence FinancePolitics

S&P 500 dip near end of May 2026

May 2026 - May 2026

Multiple remote viewers predicted a dip in the S&P 500 near the end of May 2026, possibly around May 23rd or later. The prediction is based on consensus among the team's idiograms showing a downward movement in the final third of the month. The context includes ongoing geopolitical tensions involving Iran that could affect markets. If the dip occurs, it may signal a turning point for the market.

“several of us had this kind of dip coming near the end of the month” [3:34]
S&P 500dipend of Mayremote viewingIran
Second House RV·made 5/24/2026 Source
Oil price spike late May 20263:43
Pastmedium confidence FinanceEnergyPolitics

Oil price spike late May 2026

May 2026 - May 2026

Remote viewers predicted a spike in Brent crude oil prices in the very last part of May 2026, possibly driven by geopolitical news regarding Iran or other factors. The prediction comes from multiple team members' idiograms showing an upward movement near the end of the month. The context includes existing tensions and potential news that could impact oil prices.

“I did have this feeling of a spike in kind of the very last bit of the month here” [3:43]
oilBrent crudespikeend of Maygeopolitical
Second House RV·made 5/24/2026 Source
Silver price dip and potential bump late May 20265:10
Pastmedium confidence Finance

Silver price dip and potential bump late May 2026

May 2026 - May 2026

Remote viewers predicted a dip in silver prices near the end of May 2026, followed by a possible small bump. The dip was shown in idiograms from multiple team members, with some indicating the low around the halfway point of the month. The prediction also suggests a recovery or bump in the final quarter, though with uncertainty. The context includes options expirations around May 20th that could cause price volatility.

“we all kind of showed some some dipping near the end of the month here” [5:10]
silverdipend of Mayremote viewingprice prediction
Second House RV·made 5/24/2026 Source
Geopolitical event affecting markets in early June 20267:00
Pastlow confidence PoliticsFinance

Geopolitical event affecting markets in early June 2026

May 2026 - Jun 2026

The speaker expresses a feeling that a geopolitically related event could cause a dip in markets in early June 2026 or possibly late May. This is based on personal intuition and similar feelings from a team member. The prediction is vague but suggests something related to international tensions (e.g., Iran) could impact financial markets.

“I do feel like we're maybe going to see a bit of a of a dip, something maybe geopolitically related here in in early June or maybe even late May” [7:00]
geopoliticaldipearly JunemarketsIran
Second House RV·made 5/24/2026 Source
Bioweapon Attack and Population Reduction Event8:24
Pastmedium confidence MilitaryDisastersSciencePolitics

Bioweapon Attack and Population Reduction Event

Sep 2020 - Oct 2020· Eastern Europe

The remote viewer describes a future event involving a covert release of a biological or chemical toxin, possibly via a blast or spray, in a conflict zone. The event appears to be observed by military or scientific personnel who monitor victims' reactions without intervening, suggesting a planned experiment or depopulation strategy linked to sustainability. The aftermath includes a massive crater, a severed pipeline, burnt trucks, and concentric rings of devastation. A city experiences a gray, particulate-filled sky that blocks the sun. The viewer also sees a blast wave flattening a metropolitan area similar to Hiroshima. Multiple timestamps indicate the event occurs around October 3, 2020 ±3 days, and is associated with war or war games, possibly involving an asteroid or super volcano compounding the disaster. The location is described as Eastern Europe. The viewer explicitly states that the event is a planned depopulation to bring down numbers for sustainability.

“It felt like a depopulation or a wipeout or crowd control, thinning the herd bringing the numbers down and why it felt like sustainability, resources, no space, no food. So like a planned event to reduce the population in the name of sustainability.” [8:24]
bioweapondepopulationblasttoxinHiroshimasustainability
Future Forecasters·made 5/22/2026 Source
SpaceX IPO launch in June 202610:23
Pastmedium confidence FinanceTechnology

SpaceX IPO launch in June 2026

Jun 2026 - Jun 2026

Psychic Liz Cross predicts that SpaceX will go public with its IPO in June 2026, specifically around a tentative date of June 12. The IPO is expected to be the largest of all time, with a market cap potentially reaching trillions. The prediction is based on information that SpaceX is aiming for a June launch and that the company is 'ready to go now.'

“Yes, I do feel it will. Yes.” [10:23]
SpaceXIPOJune 2026public offeringmarket cap
Psychic Liz Cross·made 5/20/2026 Source
SpaceX stock price surge on IPO day6:06
Pastmedium confidence FinanceTechnology

SpaceX stock price surge on IPO day

Jun 2026 - Jun 2026

Liz predicts that on the opening day of the SpaceX IPO, the stock price will open higher than the pre-IPO trading price of $200. She expects the price to rise rapidly within the first hour to around $500, and then settle to an average of $500-600 over time. This implies a valuation of $5-6 trillion. She believes the stock will not come back down quickly and that it will be one of the fastest upward trends in IPO history.

“I think within the first hour it could shoot to 500.” [6:06]
SpaceXstock priceIPOsurgevaluation
Psychic Liz Cross·made 5/20/2026 Source
Two competing agendas are unfolding in May 20261:30
Pastlow confidence PoliticsParanormalNews

Two competing agendas are unfolding in May 2026

May 2026 - May 2026

April claims that in May 2026, two massive agendas are unraveling simultaneously. One side, the shadow government, aims to lead humanity into a one-world order of control, censorship, depopulation, and fear. The other side, comprising the white hats and the Galactic Federation, is guiding humanity toward ascension, awakening, higher frequencies, and unity consciousness. Both sides are leveraging cosmic disclosure for their benefit.

“Right now, right? May 2026, we have the unraveling, the unfolding of two massive agendas.” [1:30]
shadow governmentone-world orderGalactic Federationascension2026
Elizabeth April·made 5/20/2026 Source
Trump was briefed on UFOs during first term but not second5:51
Pastmedium confidence PoliticsMilitary

Trump was briefed on UFOs during first term but not second

Jan 2017 - Jan 2021· United States

The channeled Trump says he received a briefing on classified UFO information during his first term (2017-2021) following an incident where US military jets were chased by UFOs. However, in his second term (2025 onward), he was not paying attention and was likely kept in the dark.

“In the first the first time around, yes. He's not really paying much attention to it now.” [5:51]
TrumpUFO briefingfirst termjets chased
Psychic Liz Cross·made 5/16/2026 Source
Tokenized silver asset launch in Q2 202621:29
Pasthigh confidence FinanceTechnology

Tokenized silver asset launch in Q2 2026

May 2026 - Jun 2026

Stream X plans to launch a tokenized silver asset in Q2 2026. It will be retail-focused, non-security, with yield generation through vaults. This is part of a broader roadmap including tokenized gold (already launched), royalties, streams, and eventually copper, oil, and gas assets.

“The next asset will be silver. That's going to be launching Q2 of this year.” [21:29]
silvertokenizationStream XQ2 2026yield
Future Forecasting Group·made 5/16/2026 Source
Trump-Xi Summit 2026: No Substantial Outcome10:28
Pastmedium confidence PoliticsMilitary

Trump-Xi Summit 2026: No Substantial Outcome

May 2026 - May 2026· Beijing, China

The remote viewing session suggests that the Trump-Xi summit in Beijing on May 14-15, 2026 will proceed as planned at expected venues, but will yield no substantial agreements or breakthroughs. The discussions will cover a wide range of topics including space, nuclear weapons, and possibly Iran and Taiwan, but the overall effect will be performative—leaders going through the motions without meaningful progress. The imagery of a bucket brigade (filling and emptying buckets repetitively) symbolizes a Sisyphean cycle where efforts lead nowhere. This prediction is based on multiple remote viewers' consensus that the summit lacks war-related tensions and feels 'devoid of war-related stuff', indicating a diplomatic stalemate.

“At the end of the day, if we take Evan's session, it's kind of just wax on, wax off. Just nothing kind of substantial comes out of it. It's just two world leaders going through the motions.” [10:28]
TrumpXi JinpingsummitBeijingno outcomeSisypheanstalemate
Future Forecasters·made 5/15/2026 Source
Mog Coin high short-term score but no longevity5:30
Pastmedium confidence Crypto

Mog Coin high short-term score but no longevity

May 2026 - May 2026

Mog Coin scores 9 out of 10 over the next 3 days, indicating a strong short-term pump, but it has no overall longevity. This suggests a quick spike then drop.

“Over the next 3 days, it's a nine. Okay. ... First of all, does it have longevity? No.” [5:30]
Mog Coinshort-termpumpno longevity
Psychic Liz Cross·made 5/13/2026 Source
Pepe scores 5 over 3 days and has longevity6:20
Pastmedium confidence Crypto

Pepe scores 5 over 3 days and has longevity

May 2026 - May 2026

Pepe scores only 5 out of 10 over the next 3 days, suggesting a potential crash first. However, it does have longevity, meaning long-term holding is viable.

“And over the next 3 days? Five. Okay, interesting. ... Does it have longevity? Yes... I feel this is about to crash down and burn first.” [6:20]
Pepeshort-termcrashlongevity
Psychic Liz Cross·made 5/13/2026 Source
Hyperliquid scores 7 over next week8:03
Pastmedium confidence Crypto

Hyperliquid scores 7 over next week

May 2026 - May 2026

Hyperliquid is predicted to score 7 out of 10 over the next week, indicating a positive short-term performance. It is currently at $40.

“How well does it do over the next week on a scale of one to 10? It's a seven.” [8:03]
Hyperliquidshort-termperformance1 week
Psychic Liz Cross·made 5/13/2026 Source
Missing scientists targeted by shadow government10:28
Pastlow confidence NewsScienceMilitaryTechnology

Missing scientists targeted by shadow government

Jan 2026 - May 2026

The remote viewer claims that a group of five scientists working on advanced technologies (anti-gravity, free energy, space-time) were targeted and taken out by the shadow government. Initially three were missing, but as of May 2026, the number has grown to 11, all under suspicious circumstances. The video suggests these scientists were eliminated because they posed a threat to major industries such as big pharma, big energy, and finance.

“I saw a group of five that were working together and that the other two were also going to get be targeted and taken out.” [10:28]
missing scientistsshadow governmentanti-gravityfree energywhistleblower
Elizabeth April·made 5/11/2026 Source
White hat organization base attacked and relocated15:00
Pastlow confidence NewsMilitary

White hat organization base attacked and relocated

Sep 2025 - May 2026· North America

According to the remote viewer, the white hat organization (a good counterpart to the shadow government) had to move its North American headquarters because it was discovered and attacked by shadow government forces. The viewer visited their new location under the guidance of a contact named Roger, who confirmed they were under attack. The exact timing is unclear but estimated to be within six to eight months prior to May 2026.

“They were under attack. They got found out and their whole facility, like their main base, got attacked.” [15:00]
white hatsshadow governmentunderground baseattackrelocation
Elizabeth April·made 5/11/2026 Source
White hats sent ultimatum to shadow government in December 202519:00
Pastlow confidence NewsPolitics

White hats sent ultimatum to shadow government in December 2025

Dec 2025 - May 2026

In December 2025, white hat hackers sent a message to Illuminati and shadow government members stating 'Walk away or we will expose you.' This led to a prediction that many CEOs, politicians, and celebrities would step down from their positions in 2026. However, the shadow government retaliated aggressively, and by May 2026 there has been increased pushback.

“They sent out a message to pretty much like these Illuminati members or Shadow Government members. And the message read something to the effect of 'Walk away or we will expose you.'” [19:00]
white hatsshadow governmentultimatumexposureresignations
Elizabeth April·made 5/11/2026 Source
Disclosure event imminent5:44
Pasthigh confidence PoliticsNewsParanormal

Disclosure event imminent

Jun 2026 - Jul 2026

The speaker predicts that a major disclosure event regarding extraterrestrials is imminent, likely triggered by Spielberg's movie 'Disclosure Day' releasing on June 12, 2026, and the Roswell anniversary in early July. The current U.S. administration needs a win and may release information, though possibly with false details. This will cause worldwide attention on the extraterrestrial situation.

“it is highly likely that something will happen soon that will cause worldwide attention to start thinking about the extraterrestrial situation” [5:44]
disclosureextraterrestrialsSpielbergRoswellU.S. administration
Farsight·made 5/11/2026 Source
Spielberg's Disclosure Day Movie Release1:30:00
Pasthigh confidence NewsPoliticsTechnology

Spielberg's Disclosure Day Movie Release

Jun 2026 - Jun 2026

Steven Spielberg's new movie 'Disclosure Day' is scheduled to be released on June 12, 2026. The speaker suggests that this event will catalyze global attention on extraterrestrial disclosure, possibly forcing mainstream media and governments to address the topic. Senior governmental figures are reportedly calling pastors to prepare congregations. The film is expected to be a major cultural moment that shifts public discourse.

“His new movie, Disclosure Day, is being released on June 12th, 2026.” [1:30:00]
disclosureextraterrestrialSpielbergmovie2026
Farsight·made 5/11/2026 Source
Release of 'Conversations with Ebanique' Video1:34:00
Pasthigh confidence TechnologyParanormal

Release of 'Conversations with Ebanique' Video

May 2026 - May 2026

Farsight has released a new video titled 'Conversations with Ebanique' featuring Courtney Brown, his son Aziz, and his ET daughter Ebanique. The video, recorded in September 2025 but held for release, depicts a conversation about ET life. It uses AI to visually depict Ebanique. This is part of a strategy to prepare audiences for disclosure.

“It was a conversation between myself, Aziz, my son, and Ebonique, my daughter. And it was done in September of 2025.” [1:34:00]
EbaniqueETconversationAIFarsight
Farsight·made 5/11/2026 Source
Roswell Anniversary as Potential Disclosure Catalyst1:30:26
Pasthigh confidence News

Roswell Anniversary as Potential Disclosure Catalyst

Jul 2026 - Jul 2026· Roswell, New Mexico

The speaker notes that the anniversary of the Roswell crash is in early July 2026, one month after Spielberg's movie release. This date is implied as another potential milestone for disclosure-related announcements or events.

“And the anniversary of the Roswell crash is early July, a month after that.” [1:30:26]
RoswellanniversarydisclosureJuly2026
Farsight·made 5/11/2026 Source
Multiple simultaneous disasters in 2020s3:24
Pastlow confidence MilitaryDisastersNews

Multiple simultaneous disasters in 2020s

Oct 2020 - Oct 2020

The remote viewer attempts a timeline and estimates the event occurs around October 3, 2020 (plus/minus 3 days). They note it could be multiple concurrent disasters: war, weapon exchange, asteroid impact, or super volcano. This combination would cause large-scale destruction and potentially alter geography. The viewer admits the date is a 'wild ass guess' due to difficulty probing.

“I felt like somewhere around 20 So, I went with 20 So, I say October 3rd, plus or minus 3 days in October 20” [3:24]
simultaneouswarasteroidsuper volcano2020
Future Forecasters·made 5/9/2026 Source
Surge in unemployment due to low-wage jobs3:19
Pastmedium confidence FinancePolitics

Surge in unemployment due to low-wage jobs

Mar 2025 - Apr 2025· United States

A remote viewer predicted a surge in people who would rather be unemployed than work low-wage jobs, citing reasons like inability to afford child care and associated costs. This was supported by data showing labor force participation rate edged down to 61.9% in March, the lowest since 1977 outside the pandemic.

“surge in people who would rather be unemployed than work low low-wage jobs... people just simply can't afford child care” [3:19]
unemploymentlow-wagelabor marketchild care
Future Forecasters·made 5/9/2026 Source
Bear market financial strategy shift15:06
Pastmedium confidence Finance

Bear market financial strategy shift

Mar 2025 - Mar 2025

A remote viewer predicted a bear market financial strategy shift. Reuters reported volatility-driven selling hit stocks in March and forced investors to reposition.

“Bear market financial strategy shift Reuters report volatility driven selling hit stocks in March and forced investors to reposition” [15:06]
bear marketvolatilitystocksreposition
Future Forecasters·made 5/9/2026 Source
Bitcoin price will revisit 75K low0:33
Pastmedium confidence CryptoFinance

Bitcoin price will revisit 75K low

May 2026 - May 2026

The remote viewer claims that Bitcoin will hit a low of $75,000 within the upcoming week, based on a previous probe that had a target of 75K and was nearly hit. This is presented as a short-term price forecast for Bitcoin, with a range already established. The prediction is specific and falsifiable.

“We were calling 75K low with a range for the week and guess what we hit.” [0:33]
Bitcoinprice forecast75Ksupport levelweek
Psychic Liz Cross·made 5/6/2026 Source
US Carrier Attack in May 20261:04
Pastmedium confidence MilitaryDisasters

US Carrier Attack in May 2026

May 2026 - May 2026

In May 2026, a US aircraft carrier will be bombarded, leading to an evacuation and abandonment of the ship. This event is described as a 'last ditch effort' and a 'defeat', with soldiers taking pictures and caskets returning, implying casualties. The prediction comes from a remote viewing session where Brian perceived a carrier under attack and subsequent evacuation.

“My event one I just saw this to me just felt like a last ditch effort. Like this this carrier was just being bombarded and these guys are just trying to evacuate as quickly as they can.” [1:04]
US carrierattackevacuationcasualtiesMay 2026
Future Forecasters·made 5/3/2026 Source
US Land Invasion in May 20261:53
Pastmedium confidence MilitaryPolitics

US Land Invasion in May 2026

May 2026 - May 2026

The United States will conduct a land invasion involving US Marines in May 2026. This is predicted by Brian, who saw marines moving into a strait and a land invasion effort possibly by the US, with escorts leading soldiers.

“there's some like land invasion maybe there are there are marines that's going to your right. Um and they're trying to control it maybe the US. Uh in land invasion by the US” [1:53]
USland invasionMarineswarMay 2026
Future Forecasters·made 5/3/2026 Source
Ammunition Shortage in May 20262:01
Pastlow confidence MilitaryFinance

Ammunition Shortage in May 2026

May 2026 - May 2026

A significant ammunition shortage will occur in May 2026, reminiscent of conditions in 2010. The prediction includes a warning to 'stock up', suggesting a supply crisis affecting military or civilian access.

“event three I got ammo shortage time to stock up. This felt like 2010 all over again.” [2:01]
ammunitionshortagestock upcrisis2026
Future Forecasters·made 5/3/2026 Source
Memorial with Hundreds of Flags in May 20262:07
Pastlow confidence MilitaryPolitics

Memorial with Hundreds of Flags in May 2026

May 2026 - May 2026

Hundreds of small flags will be placed in a flat area as a memorial, associated with emotions of hate, anger, sadness, and regret. This likely commemorates war dead or a mass casualty event.

“all these little flags just like all over a flat area just set in the ground just hundreds of them up for like a memorial. Lots of emotion. I got like hate anger sadness regret.” [2:07]
memorialflagsemotionwar deadMay 2026
Future Forecasters·made 5/3/2026 Source
Oil Slick and No Survivors at Sea in May 20262:12
Pastmedium confidence DisastersMilitary

Oil Slick and No Survivors at Sea in May 2026

May 2026 - May 2026

An oil slick from a ship attack will be found, with 'no survivors' and ash or soot in the air, indicating a catastrophic event at sea, possibly a sunken vessel or explosion.

“an oil slick and free floating in the water. This might be related to to Brian's ship attack. A lot of ash or like soot in the air and I got no survivors.” [2:12]
oil slickno survivorsship attackashsea
Future Forecasters·made 5/3/2026 Source
US Trump War Powers Debate in May 20262:20
Pasthigh confidence Politics

US Trump War Powers Debate in May 2026

May 2026 - May 2026· US

A debate over Trump's war powers will continue in May 2026, focusing on loopholes and opposition. This is a political prediction regarding the scope of presidential authority in military conflicts.

“US Trump war powers debate presses on loopholes and opposition.” [2:20]
Trumpwar powersdebateloopholesopposition
Future Forecasters·made 5/3/2026 Source
Charlie Kirk Murder Revelation in May 20262:25
Pastlow confidence NewsPolitics

Charlie Kirk Murder Revelation in May 2026

May 2026 - May 2026· US

A new theory regarding the murder of Charlie Kirk will be revealed in May 2026. The prediction does not specify details but suggests a significant development in the case.

“Charlie Kirk murder revelation new theory.” [2:25]
Charlie Kirkmurderrevelationtheory2026
Future Forecasters·made 5/3/2026 Source
California Fraud Scandal Linked to State Politicians in May 20262:30
Pastmedium confidence Politics

California Fraud Scandal Linked to State Politicians in May 2026

May 2026 - May 2026· US

New probes and allegations will link fraud in California to state politicians, leading to more distractions. This suggests a corruption scandal involving state government officials.

“US California fraud links to state politicians more probes more allegations more distractions.” [2:30]
Californiafraudpoliticiansprobesscandal
Future Forecasters·made 5/3/2026 Source
US-Iran Negotiations Fail, More Bombs Over Tehran in May 20262:36
Pasthigh confidence MilitaryPolitics

US-Iran Negotiations Fail, More Bombs Over Tehran in May 2026

May 2026 - May 2026· Iran

Iran-US negotiations will not align, leading to more bombings over Tehran. This indicates a continuation or escalation of military conflict between the US and Iran.

“Iran US negotiations not aligned more bombs over Tehran.” [2:36]
IranUSnegotiationsbombsTehran
Future Forecasters·made 5/3/2026 Source
Major earthquake in mountainous region1:50
Pastmedium confidence EnvironmentDisasters

Major earthquake in mountainous region

May 2026 - Jun 2026

The remote viewer predicts a large earthquake occurring in a mountainous area, leading to falling boulders, crushed buildings, and loss of life. Earthquakes are common, but this prediction specifically highlights significant damage and casualties. The event may happen within a couple of months from the session date (April 25, 2026), so likely in May or June 2026.

“It came to mind a big earthquake in the mountains with boulders falling and buildings crushed, loss of life.” [1:50]
earthquakemountainsbouldersbuildingscrushedloss of life
Future Forecasters·made 5/2/2026 Source
AI model upgrade or introduction causing conflict0:49
Pastmedium confidence TechnologyScience

AI model upgrade or introduction causing conflict

May 2026 - May 2026

A new or upgraded AI model will be introduced, possibly leading to a conflict between two AI systems. This may not be widely reported but involves AI units attacking each other. The prediction stems from remote viewing sessions and suggests a significant event in AI development.

“AI model gets upgraded or introduced to the world. It might not get reported as such, but it can be seen is conflicting AI units or even systems attack.” [0:49]
AI upgradeconflictsystems attack
Future Forecasters·made 5/1/2026 Source
Streets go dark from war-related grid hit1:10
Pastmedium confidence MilitaryEnergyDisasters

Streets go dark from war-related grid hit

May 2026 - May 2026· Strait of Hormuz

A scenario where streets go dark due to a war-related incident, but not in a typical war zone. A power grid is hit and goes down, possibly resembling a 'three days of darkness' scenario. The image includes a burning oil well or refinery near a winding body of water, likely the Strait of Hormuz.

“Streets go dark scenario. Possibly war related, though not in an area that has been hit by war. More like a grid gets hit and goes down.” [1:10]
power griddarknessoil refineryStrait of Hormuz
Future Forecasters·made 5/1/2026 Source
Powerful cyber attack on financial networks1:57
Pastmedium confidence TechnologyFinance

Powerful cyber attack on financial networks

May 2026 - May 2026

A news story about a powerful cyber attack that targets money or financial networks. The attack is described as coming from the sky, possibly indicating a space-based or sophisticated source. It is expected to be very dramatic.

“Cyber hits. A news story about a powerful cyber attack. Like it hits money or financial networks.” [1:57]
cyber attackfinancial networksspace-based
Future Forecasters·made 5/1/2026 Source
Large meteor hitting atmosphere with loud booms2:12
Pastlow confidence SpaceDisasters

Large meteor hitting atmosphere with loud booms

May 2026 - May 2026

A large meteor will hit the atmosphere, causing large boom sounds and dramatic events. This is described as a big event, possibly observable from the ground.

“There's a thing coming in. It looks like a large meteor that hits the atmosphere. Large boom sounds.” [2:12]
meteoratmosphereboom
Future Forecasters·made 5/1/2026 Source
Prisoner of war or hostage scenario with chains2:50
Pastmedium confidence MilitaryPolitics

Prisoner of war or hostage scenario with chains

May 2026 - May 2026· Middle East

Multiple people will be seen wearing handcuffs and chained together, suggesting a prisoner of war or hostage scenario. This involves negotiations and resembles images from the October 7th Israel strike.

“I get a imagery of more than one person, multiple people wearing cuffs behind either in front or behind, but the idea here is like they're chained together. So, this is something that you would see like prisoner of war type scenario or hostage type scenario.” [2:50]
prisonershostageschainsMiddle East
Future Forecasters·made 5/1/2026 Source
Lunar eclipse or partial eclipse observation3:15
Pastmedium confidence ScienceSpace

Lunar eclipse or partial eclipse observation

May 2026 - May 2026

The moon will exhibit an eclipse or partial eclipse, with the word 'ecliptic' coming to mind. People will be talking about this celestial observation.

“I saw the moon. The idea is like an eclipse or partially eclipse. The word ecliptic comes to mind. Some type of observation of the moon that people are going to be talking about.” [3:15]
mooneclipseobservation
Future Forecasters·made 5/1/2026 Source
Guided missile aimed at infrastructure in Iran3:22
Pastmedium confidence MilitaryPolitics

Guided missile aimed at infrastructure in Iran

May 2026 - May 2026· Iran

A seeking missile launches, reorients itself, and flies away aimed at infrastructure, with a direct hit and retaliation. The location is the Middle East, specifically Iran.

“I see a seeking missile guided cuz it shoots up and then it kind of reorients itself and I see it fly away. Aimed at infrastructure. The idea of a direct hit. Retaliation. Middle East, Iran comes to mind.” [3:22]
missileinfrastructureretaliationIran
Future Forecasters·made 5/1/2026 Source
Chemical leak contamination requiring hazmat suits3:37
Pastlow confidence DisastersHealth

Chemical leak contamination requiring hazmat suits

May 2026 - May 2026· Western

A person in a breathing mask and hazmat suit indicates a leak or contamination event. The location is likely a Western country.

“A person in breathing mask and you know, like almost like hazmat type suit here. And the probe is leak contamination. And you know, I the location I'm not so sure on, but it felt maybe like this was more of a western thing.” [3:37]
hazmatleakcontaminationchemical
Future Forecasters·made 5/1/2026 Source
Financial news with crisis management and optimism3:46
Pastlow confidence Finance

Financial news with crisis management and optimism

May 2026 - May 2026

Financial news for May involves crisis management and escalating situations, but with an undercurrent of optimism.

“Financial news for May. Crisis management. Escalating situations, but I get the idea of optimism.” [3:46]
crisismanagementoptimism
Future Forecasters·made 5/1/2026 Source
ChatGPT will release a model that makes it the top AI in months10:45
Pastlow confidence TechnologyNews

ChatGPT will release a model that makes it the top AI in months

Jun 2026 - Jul 2026

The session predicts that ChatGPT (OpenAI) will release a new AI model within the next couple of months that will surpass Anthropic's Claude, placing OpenAI back at the forefront of the AI race. The model will be compatible with something called 'workflow' and will focus on cost-effectiveness.

“ChatGPT is going to release something that's going to put them at the top of the heap soon, within the next couple months.” [10:45]
ChatGPTOpenAIAI raceworkflowcost
Psychic Liz Cross·made 5/1/2026 Source
Pepe (Ethereum) short-term pump then dump2:00
Pastmedium confidence Crypto

Pepe (Ethereum) short-term pump then dump

Apr 2026 - May 2026

Pepe token on Ethereum will experience a short-term surge within a few days, reaching a score of 7 out of 10 in performance, and has the potential to double from its current price. However, after that brief period, it will plummet (dump) and ultimately fail, with no long-term viability. This is a high-risk, speculative opportunity.

“It's a seven, but I feel like the seven is really more for the next couple of days then it's going to dump out and just go bye-bye.” [2:00]
PepeEthereummeme coinpump and dumpshort-term
Psychic Liz Cross·made 4/29/2026 Source
Morpheus short-term pump then dump6:24
Pastmedium confidence Crypto

Morpheus short-term pump then dump

Apr 2026 - May 2026

Morpheus token will perform very poorly (2 out of 10) over three months, but will have a short-term spike rated 7 out of 10 within the next week. No long-term viability.

“Over the next 3 months, that's a two. But over the next like say week, it's a seven over the next week.” [6:24]
Morpheusshort-termpumpcryptono longevity
Psychic Liz Cross·made 4/29/2026 Source
Staged assassination attempt on Donald Trump1:11
Pastlow confidence PoliticsNews

Staged assassination attempt on Donald Trump

Apr 2026 - Apr 2026

Remote viewing reveals that the assassination attempt on Donald Trump on April 25, 2026 was staged. Trump was present in a boardroom meeting with about 15 men in suits where the plan was briefed, and although the idea was not originally his, it came from his team. The purpose was to rally waning support, increase financial backing, and gain acceptance for certain projects, mimicking the effect of the 2024 shooting that boosted his support.

“A plan to stage an attempted assassination.” [1:11]
Trumpstaged assassinationremote viewingboardroom meetingApril 25 2026
Elizabeth April·made 4/27/2026 Source
Staged Trump assassination attempt to rally support10:28
Pastmedium confidence PoliticsMilitaryNews

Staged Trump assassination attempt to rally support

Oct 2025 - Apr 2026· United States

The remote viewer claims that the April 25, 2026 shooting at the White House Correspondents' Dinner was a staged event planned by a group of about 15 men, including Donald Trump, in a secret meeting 6-8 months earlier. The purpose was to rally the masses, increase sympathy and support for Trump, create a distraction from other issues, and secure more funding for certain projects. The shooter, Cole Thomas Allen, was allegedly a disgruntled individual contacted online and manipulated into carrying out the plan with limited information.

“The Trump shooting was staged, but it was staged from the inside.” [10:28]
Trumpassassination attemptstagedremote viewingshooting
Elizabeth April·made 4/27/2026 Source
Major alien disclosure event in early summer 202618:56
Pastlow confidence WoowooScienceNews

Major alien disclosure event in early summer 2026

Jun 2026 - Jun 2026

The remote viewer senses that a significant government-led alien disclosure is imminent, occurring around early summer 2026. This is described as a 'soft approach' that will surprise the average person. The disclosure is part of a larger pattern of revelations about hidden agendas and conspiracies.

“I keep feeling, and I'm pretty sure I said this in my 2026 prediction video, but disclosure happening around like early summer.” [18:56]
alien disclosuregovernmentsummer 2026remote viewing
Elizabeth April·made 4/27/2026 Source
North Korea military parade in May 20263:12
Pastmedium confidence PoliticsMilitary

North Korea military parade in May 2026

May 2026 - May 2026· North Korea

The remote viewer describes a military parade event in May 2026, likely in North Korea, featuring an old man on a balcony, tall persons in military dress with peaked hats and sashes, and parades of dummy nuclear missiles. The viewer states that the timing of this event is critical and sends a clear message, making it one to watch. The individual behind this will become more prominent in the news. This is based on vivid imagery of a 'dictator with military uniforms' and 'cardboard nuclear missiles' paraded in a square.

“keep your eye out in May for one of these dictator with the military uniforms parades the missiles up and down events cuz I think this is going to be one to watch” [3:12]
military paradeNorth Koreadictatormissilespropaganda
Second House RV·made 4/27/2026 Source
Financial market volatility in May 20265:20
Pastmedium confidence Finance

Financial market volatility in May 2026

May 2026 - Jun 2026

Remote viewer Alyssa predicts intense financial repercussions for the first three weeks of May 2026, with an 'earth-shattering feeling' affecting business. The viewer senses a shake-up lasting about six weeks, with protesters and angry people around a tall, blue mirrored building that symbolizes wealth. The building's primary function is financial, and there is a sense of something or someone trying to break in and take over. This prediction is based on abstract sensations of shaking and red balls of energy moving toward the building.

“for the first three weeks in May, it'll be really hard. So for business in general, there's like this earth-shattering feeling associated with it financially.” [5:20]
financial volatilitybusiness shake-upprotestwealthturmoil
Second House RV·made 4/27/2026 Source
Release of pressure in financial markets late May 20269:57
Pastmedium confidence Finance

Release of pressure in financial markets late May 2026

May 2026 - May 2026

Remote viewer Han describes a symbolic 'valve opening' and release of steam or smoke, indicating a relief of pressure in financial markets later in May 2026. The feeling is of nervousness and anxiety initially, followed by a big sigh of relief. Han also perceives a 'smoke and mirrors' element, suggesting that a big event might not be presented honestly but eventually gets captured. This is linked to the S&P 500 and other financial targets, with a peak expected near the end of the month.

“there's going to be some kind of release of or relief of pressure at some point in the month” [9:57]
market reliefpressure releaseS&P 500volatilitysigh of relief
Second House RV·made 4/27/2026 Source
Hydrograph Clean Energy stock price drop and recovery in April-May 2026
Pastmedium confidence FinanceTechnology

Hydrograph Clean Energy stock price drop and recovery in April-May 2026

Mar 2026 - May 2026

The session predicts that the stock price of Hydrograph Clean Energy will experience a dip in early to mid-April 2026, reaching a low around April 7th, followed by a recovery and then further fluctuation. The remote viewing ideogram indicates a steep drop in early May, possibly triggered by a major decision or announcement (like a tweet or speech) that causes initial market fear but proves to be mostly 'bark, no bite', with prices recovering. The prediction is based on two remote viewing sessions: one covering March 30 to May 31, 2026, and another for April only. The low has already been confirmed at April 7th, with the stock recovering from 580 to 718 Canadian dollars by April 10th. The future May drop is expected to be announcement-driven but not catastrophic.

“the low you've got at sort of the three-quarter mark there, um, is pretty consistent with, uh, the the ideogram that I did for this” [0:00]
Hydrograph Clean Energystock pricegraphenemarket predictionremote viewing
Second House RV·made 4/15/2026 Source
Market dip due to announcement in early May 202618:53
Pastmedium confidence PoliticsFinance

Market dip due to announcement in early May 2026

May 2026 - May 2026

The session identifies a point in the ideogram (marked B) as a major decision or announcement that causes a market downturn. This is described as similar to a 'Trump tweet or speech' that threatens to 'end civilization' but ultimately results in a quick recovery. The prediction is that a singular global event (likely political) will cause a sharp but temporary drop in financial markets in early May 2026. The event is characterized as 'all bark, no bite', suggesting the market will bounce back rapidly.

“it kind of feels like what we were just talking about... this speech Trump gave... I'm going to end civilization” [18:53]
market dipannouncementglobal impactquick recoveryTrump
Second House RV·made 4/15/2026 Source
Disclosure approaching within months4:08
Pastmedium confidence NewsWoowooPoliticsScience

Disclosure approaching within months

Apr 2026 - Jul 2026

The speaker asserts that disclosure of extraterrestrial presence is approaching rapidly and will happen within the next few months. This prediction is based on the speaker's observations of increasing public discussion and normalization of the topic.

“And wow, is it approaching. It looks like it's really heading up for something that's going to be happening um well within the next few months.” [4:08]
disclosureextraterrestrialUFOgovernmentmonths
Farsight·made 4/6/2026 Source
Destructive explosion in a densely populated urban area5:00
Pastmedium confidence DisastersMilitaryNews

Destructive explosion in a densely populated urban area

Apr 2026 - Apr 2026· Hong Kong or Taiwan (potential)

A destructive event involving a large explosion occurs in a dense, landlocked urban area surrounded by mountains, possibly resembling Hong Kong or Taiwan. A tall structure under construction or derelict is the main impact point. The explosion is expansive and swelling, starting small then building, with a percussive auditory sensation. It causes shock, fear, and disbelief among onlookers. The event feels like an act of God and may involve a missile or air strike.

“The destructive force in question felt expansive and growing or swelling in nature. Small at first and then building and building and building and building in size.” [5:00]
explosionurbanstructuremissileshock
Second House RV·made 4/4/2026 Source
VIX Volatility Spike Mid-April 20263:03
Pastmedium confidence Finance

VIX Volatility Spike Mid-April 2026

Apr 2026 - Apr 2026

One or more remote viewers (the host, David Harker, and Rich) independently predicted that the VIX volatility index would experience a peak between April 15th and April 20th, 2026, followed by a cooling later in the month. The prediction is based on blind remote viewing sessions conducted by multiple viewers, with their charts showing a spike around that window. The context includes ongoing global events such as war in the Middle East, which are contributing to already high volatility. The predicted pattern suggests a short-term increase in market turbulence around that period.

“the peak of volatility for the month happening kind of around that 15th to 20th sort of window” [3:03]
VIXvolatilitystock marketApril 2026remote viewing
Second House RV·made 4/1/2026 Source

Undated

2
Ancient Martian Civilization with Advanced Architecture0:22
Undatedlow confidence ScienceSpaceParanormal

Ancient Martian Civilization with Advanced Architecture

-1000000-01-01· Mars

The CIA remote viewing session from 1984, replicated by Dr. Q in 2025, describes structures on Mars that were built approximately 1 million years ago by tall, thin beings. These structures include megalithic walls with 90-degree angles, enormous interior spaces resembling a rabbit warren, and square structures flush with the ground that reflect light. The beings are described as ancient, wearing fitted clothing, and experiencing grief and urgency as their environment was collapsing. They sent a scouting party to find another habitable location. The prediction is that these structures and beings existed on Mars in the distant past, with the scouting party possibly arriving on Earth.

“The viewer sat down and described structures on Mars 1 million years ago.” [0:22]
Marsremote viewingancient civilizationCIAStargate programstructures
Dr. Q·made 5/27/2026 Source
Scouting Party Sent from Mars to Find a New Home6:45
Undatedlow confidence ScienceSpaceParanormal

Scouting Party Sent from Mars to Find a New Home

-1000000-01-01· Mars

According to the remote viewing session, the ancient beings on Mars dispatched a scouting party to find somewhere else to live, as their environment was failing. Dr. Q hints that he has a hunch where this scouting party went, implying they may have come to Earth. The prediction suggests that extraterrestrial beings (possibly ancestors of humans or another species) arrived on Earth after leaving Mars around 1 million years ago.

“And they sent a group away, and not an evacuation, a scouting party, if you will.” [6:45]
scouting partyextraterrestrialevacuationMarsremote viewing
Dr. Q·made 5/27/2026 Source